AIG1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: AIG1_HUMAN
• UniProt AC: Q9NVV5
• Protein Name: Androgen-induced gene 1 protein
• Gene Name: AIG1
• Organism: Homo sapiens (Human).
• Sequence Length: 245
• Subcellular Localization: Membrane ; Multi-pass membrane protein .
• Protein Description: May play a role in androgen-regulated growth of hair follicles..
• Protein Sequence: MALVPCQVLRMAILLSYCSILCNYKAIEMPSHQTYGGSWKFLTFIDLVIQAVFFGICVLTDLSSLLTRGSGNQEQERQLKKLISLRDWMLAVLAFPVGVFVVAVFWIIYAYDREMIYPKLLDNFIPGWLNHGMHTTVLPFILIEMRTSHHQYPSRSSGLTAICTFSVGYILWVCWVHHVTGMWVYPFLEHIGPGARIIFFGSTTILMNFLYLLGEVLNNYIWDTQKKPPSWQDMKIKFMYLGPSS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
64	Phosphorylation	CVLTDLSSLLTRGSG HHHHHHHHHHHCCCC	34.39	24719451
70	Phosphorylation	SSLLTRGSGNQEQER HHHHHCCCCCHHHHH	31.14	46160973
230	Phosphorylation	DTQKKPPSWQDMKIK CCCCCCCCHHHCEEE	45.99	26471730

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of AIG1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of AIG1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of AIG1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ZN363_HUMAN	RCHY1	physical	21622095
ZN363_HUMAN	RCHY1	physical	21988832

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.