dbPTM

AIFM2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	AIFM2_MOUSE
UniProt AC	Q8BUE4
Protein Name	Apoptosis-inducing factor 2
Gene Name	Aifm2
Organism	Mus musculus (Mouse).
Sequence Length	373
Subcellular Localization	Cytoplasm. Mitochondrion outer membrane. Membrane Lipid-anchor .
Protein Description	Oxidoreductase, which may play a role in mediating a p53/TP53-dependent apoptosis response. Probable oxidoreductase that acts as a caspase-independent mitochondrial effector of apoptotic cell death (By similarity). May contribute to genotoxin-induced growth arrest..
Protein Sequence	MGSQVSVDTGAVHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVESGFAKKTFISYSATFKDNFRQGKVIGIDLKNRMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSCQQAAIQAYEDMVKQIQRSQFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSRVPLADKELLPCVRQEVKEILLRKGVQLLLSERVSNLEELPRNEYREYIKVETDKGTEVATNMVIVCNGIKINSSAYRSAFESRLASNGALKVNEFLQVEGYSNIYAIGDCADTKEPKMAYHAGLHANVAVANIVNSMKQRPLKAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLAKSRDLLISTSWKTMRQSPP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of AIFM2_MOUSE !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of AIFM2_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of AIFM2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of AIFM2_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of AIFM2_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of AIFM2_MOUSE

Related Literatures of Post-Translational Modification