UniProt ID | AIF1_HUMAN | |
---|---|---|
UniProt AC | P55008 | |
Protein Name | Allograft inflammatory factor 1 | |
Gene Name | AIF1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 147 | |
Subcellular Localization |
Cytoplasm, cytoskeleton . Cell projection, ruffle membrane Peripheral membrane protein Cytoplasmic side . Cell projection, phagocytic cup . Associated with the actin cytoskeleton at membrane ruffles and at sites of phagocytosis. |
|
Protein Description | Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation.. | |
Protein Sequence | MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSQTRDLQG ------CCCCCCCCC | 40.01 | 28450419 | |
2 | Acetylation | ------MSQTRDLQG ------CCCCCCCCC | 40.01 | - | |
4 | Phosphorylation | ----MSQTRDLQGGK ----CCCCCCCCCCH | 20.88 | 27486199 | |
11 | Acetylation | TRDLQGGKAFGLLKA CCCCCCCHHHHHHHH | 47.57 | 19608861 | |
11 | Ubiquitination | TRDLQGGKAFGLLKA CCCCCCCHHHHHHHH | 47.57 | 21890473 | |
22 | Ubiquitination | LLKAQQEERLDEINK HHHHHHHHHHHHHHH | 54.96 | 21890473 | |
37 | Phosphorylation | QFLDDPKYSSDEDLP HHHCCCCCCCCCCCC | 20.85 | 28450419 | |
38 | Phosphorylation | FLDDPKYSSDEDLPS HHCCCCCCCCCCCCH | 37.12 | 23401153 | |
39 | Phosphorylation | LDDPKYSSDEDLPSK HCCCCCCCCCCCCHH | 41.76 | 28355574 | |
45 | Phosphorylation | SSDEDLPSKLEGFKE CCCCCCCHHCCCHHH | 58.11 | 28450419 | |
54 | Phosphorylation | LEGFKEKYMEFDLNG CCCHHHHHHHCCCCC | 11.72 | 2010525 | |
66 (in isoform 3) | Phosphorylation | - | 34.97 | - | |
69 | Phosphorylation | NGDIDIMSLKRMLEK CCCCCHHHHHHHHHH | 30.95 | 68735927 | |
69 (in isoform 3) | Phosphorylation | - | 30.95 | - | |
76 | Ubiquitination | SLKRMLEKLGVPKTH HHHHHHHHHCCCHHH | 46.72 | 21890473 | |
81 | Ubiquitination | LEKLGVPKTHLELKK HHHHCCCHHHHHHHH | 46.28 | - | |
88 | Ubiquitination | KTHLELKKLIGEVSS HHHHHHHHHHCCCCC | 58.94 | 21890473 | |
113 | Methylation | FLRMMLGKRSAILKM HHHHHHCCHHHHHHH | 38.94 | - | |
124 | Phosphorylation | ILKMILMYEEKAREK HHHHHHHHHHHHHHH | 19.93 | 29759185 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AIF1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AIF1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of AIF1_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-11, AND MASS SPECTROMETRY. |