| UniProt ID | AGP9_ARATH | |
|---|---|---|
| UniProt AC | Q9C5S0 | |
| Protein Name | Classical arabinogalactan protein 9 | |
| Gene Name | AGP9 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 191 | |
| Subcellular Localization |
Cell membrane Lipid-anchor, GPI-anchor . |
|
| Protein Description | Proteoglycan that seems to be implicated in diverse developmental roles such as differentiation, cell-cell recognition, embryogenesis and programmed cell death.. | |
| Protein Sequence | MARSFAIAVICIVLIAGVTGQAPTSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPSPSSSPPLPSSDAPGPSTDSISPAPSPTDVNDQNGASKMVSSLVFGSVLVWFMI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 21 | Pyrrolidone_carboxylic_acid | LIAGVTGQAPTSPPT HHHCCCCCCCCCCCC | 34.50 | - | |
| 21 | Pyrrolidone_carboxylic_acid | LIAGVTGQAPTSPPT HHHCCCCCCCCCCCC | 34.50 | 11006345 | |
| 21 | Pyrrolidone_carboxylic_acid | LIAGVTGQAPTSPPT HHHCCCCCCCCCCCC | 34.50 | 11006345 | |
| 23 | Hydroxylation | AGVTGQAPTSPPTAT HCCCCCCCCCCCCCC | 26.06 | 11006345 | |
| 26 | Hydroxylation | TGQAPTSPPTATPAP CCCCCCCCCCCCCCC | 32.51 | 11006345 | |
| 26 | O-linked_Glycosylation | TGQAPTSPPTATPAP CCCCCCCCCCCCCCC | 32.51 | - | |
| 27 | Hydroxylation | GQAPTSPPTATPAPP CCCCCCCCCCCCCCC | 34.14 | 11006345 | |
| 27 | O-linked_Glycosylation | GQAPTSPPTATPAPP CCCCCCCCCCCCCCC | 34.14 | - | |
| 31 | Hydroxylation | TSPPTATPAPPTPTT CCCCCCCCCCCCCCC | 40.06 | 11006345 | |
| 31 | O-linked_Glycosylation | TSPPTATPAPPTPTT CCCCCCCCCCCCCCC | 40.06 | - | |
| 33 | Hydroxylation | PPTATPAPPTPTTPP CCCCCCCCCCCCCCC | 34.20 | 11006345 | |
| 33 | O-linked_Glycosylation | PPTATPAPPTPTTPP CCCCCCCCCCCCCCC | 34.20 | - | |
| 172 | GPI-anchor | TDVNDQNGASKMVSS CCCCCCCHHHHHHHH | 26.12 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AGP9_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AGP9_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AGP9_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of AGP9_ARATH !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
