UniProt ID | AGP9_ARATH | |
---|---|---|
UniProt AC | Q9C5S0 | |
Protein Name | Classical arabinogalactan protein 9 | |
Gene Name | AGP9 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 191 | |
Subcellular Localization |
Cell membrane Lipid-anchor, GPI-anchor . |
|
Protein Description | Proteoglycan that seems to be implicated in diverse developmental roles such as differentiation, cell-cell recognition, embryogenesis and programmed cell death.. | |
Protein Sequence | MARSFAIAVICIVLIAGVTGQAPTSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPSPSSSPPLPSSDAPGPSTDSISPAPSPTDVNDQNGASKMVSSLVFGSVLVWFMI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
21 | Pyrrolidone_carboxylic_acid | LIAGVTGQAPTSPPT HHHCCCCCCCCCCCC | 34.50 | - | |
21 | Pyrrolidone_carboxylic_acid | LIAGVTGQAPTSPPT HHHCCCCCCCCCCCC | 34.50 | 11006345 | |
21 | Pyrrolidone_carboxylic_acid | LIAGVTGQAPTSPPT HHHCCCCCCCCCCCC | 34.50 | 11006345 | |
23 | Hydroxylation | AGVTGQAPTSPPTAT HCCCCCCCCCCCCCC | 26.06 | 11006345 | |
26 | Hydroxylation | TGQAPTSPPTATPAP CCCCCCCCCCCCCCC | 32.51 | 11006345 | |
26 | O-linked_Glycosylation | TGQAPTSPPTATPAP CCCCCCCCCCCCCCC | 32.51 | - | |
27 | Hydroxylation | GQAPTSPPTATPAPP CCCCCCCCCCCCCCC | 34.14 | 11006345 | |
27 | O-linked_Glycosylation | GQAPTSPPTATPAPP CCCCCCCCCCCCCCC | 34.14 | - | |
31 | Hydroxylation | TSPPTATPAPPTPTT CCCCCCCCCCCCCCC | 40.06 | 11006345 | |
31 | O-linked_Glycosylation | TSPPTATPAPPTPTT CCCCCCCCCCCCCCC | 40.06 | - | |
33 | Hydroxylation | PPTATPAPPTPTTPP CCCCCCCCCCCCCCC | 34.20 | 11006345 | |
33 | O-linked_Glycosylation | PPTATPAPPTPTTPP CCCCCCCCCCCCCCC | 34.20 | - | |
172 | GPI-anchor | TDVNDQNGASKMVSS CCCCCCCHHHHHHHH | 26.12 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AGP9_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AGP9_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AGP9_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of AGP9_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...