AGP6_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: AGP6_ARATH
• UniProt AC: Q9LY91
• Protein Name: Classical arabinogalactan protein 6
• Gene Name: AGP6
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 150
• Subcellular Localization: Cell membrane ; Lipid-anchor, GPI-anchor .
• Protein Description: Proteoglycan that seems to be implicated in diverse developmental roles such as differentiation, cell-cell recognition, embryogenesis and programmed cell death (By similarity). Plays an important role during the formation of the nexine layer of the pollen wall. [PubMed: 25336567]
• Protein Sequence: MARQFVVLVLLTLTIATAFAADAPSASPKKSPSPTAAPTKAPTATTKAPSAPTKAPAAAPKSSSASSPKASSPAAEGPVPEDDYSASSPSDSAEAPTVSSPPAPTPDSTSAADGPSDGPTAESPKSGAVTTAKFSVVGTVATVGFFFFSF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
126	GPI-anchor	PTAESPKSGAVTTAK CCCCCCCCCCEEEEE	35.05	-
131	Phosphorylation	PKSGAVTTAKFSVVG CCCCCEEEEEEEECE	22.66	26811356

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of AGP6_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of AGP6_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of AGP6_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.