AGP26_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: AGP26_ARATH
• UniProt AC: Q94F57
• Protein Name: Classical arabinogalactan protein 26
• Gene Name: AGP26
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 136
• Subcellular Localization: Cell membrane ; Lipid-anchor, GPI-anchor .
• Protein Description: Proteoglycan that seems to be implicated in diverse developmental roles such as differentiation, cell-cell recognition, embryogenesis and programmed cell death..
• Protein Sequence: MSVSLFTAFTVLSLCLHTSTSEFQLSTISAAPSFLPEAPSSFSASTPAMSPDTSPLFPTPGSSEMSPSPSESSIMPTIPSSLSPPNPDAVTPDPLLEVSPVGSPLPASSSVCLVSSQLSSLLLVLLMLLLAFCSFF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
108	GPI-anchor	VGSPLPASSSVCLVS CCCCCCCCCHHHHHH	22.62	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of AGP26_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of AGP26_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of AGP26_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of AGP26_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.