AGP24_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: AGP24_ARATH
• UniProt AC: Q5PP12
• Protein Name: Arabinogalactan protein 24 {ECO:0000303|PubMed:12177459}
• Gene Name: AGP24 {ECO:0000303|PubMed:12177459}
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 69
• Subcellular Localization: Cell membrane ; Lipid-anchor, GPI-anchor .
• Protein Description: Proteoglycan that seems to be implicated in diverse developmental roles such as differentiation, cell-cell recognition, embryogenesis and programmed cell death..
• Protein Sequence: MMMMTKMFVQIAVVCLLATMAVVSAHEGHHHHAPAPAPGPASSSTVVSATNMFTVLAIAAVALVVGSNH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
34	O-linked_Glycosylation	EGHHHHAPAPAPGPA CCCCCCCCCCCCCCC	34.13	15322080
34	Hydroxylation	EGHHHHAPAPAPGPA CCCCCCCCCCCCCCC	34.13	15322080
36	O-linked_Glycosylation	HHHHAPAPAPGPASS CCCCCCCCCCCCCCC	37.62	15322080
36	Hydroxylation	HHHHAPAPAPGPASS CCCCCCCCCCCCCCC	37.62	15322080
38	O-linked_Glycosylation	HHAPAPAPGPASSST CCCCCCCCCCCCCCC	48.52	15322080
38	Hydroxylation	HHAPAPAPGPASSST CCCCCCCCCCCCCCC	48.52	15322080
40	O-linked_Glycosylation	APAPAPGPASSSTVV CCCCCCCCCCCCCHH	28.10	15322080
40	Hydroxylation	APAPAPGPASSSTVV CCCCCCCCCCCCCHH	28.10	15322080
42	GPI-anchor	APAPGPASSSTVVSA CCCCCCCCCCCHHCC	28.14	15322080

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of AGP24_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
34	P	Hydroxylation	Contains 4-hydroxyproline; hydroxylated on Pro-34, Pro-36, Pro-38 and Pro-40.	15322080
36	P	Hydroxylation	Contains 4-hydroxyproline; hydroxylated on Pro-34, Pro-36, Pro-38 and Pro-40.	15322080
38	P	Hydroxylation	Contains 4-hydroxyproline; hydroxylated on Pro-34, Pro-36, Pro-38 and Pro-40.	15322080
40	P	Hydroxylation	Contains 4-hydroxyproline; hydroxylated on Pro-34, Pro-36, Pro-38 and Pro-40.	15322080

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of AGP24_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of AGP24_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.