AGP15_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: AGP15_ARATH
• UniProt AC: Q9LYF6
• Protein Name: Arabinogalactan protein 15 {ECO:0000303|PubMed:11006345}
• Gene Name: AGP15 {ECO:0000303|PubMed:11006345}
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 61
• Subcellular Localization: Cell membrane ; Lipid-anchor, GPI-anchor .
• Protein Description: Proteoglycan that seems to be implicated in diverse developmental roles such as differentiation, cell-cell recognition, embryogenesis and programmed cell death..
• Protein Sequence: MAISKASIVVLMMVIISVVASAQSEAPAPSPTSGSSAISASFVSAGVAAVAALVFGSALRI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
23	Pyrrolidone_carboxylic_acid	ISVVASAQSEAPAPS HHHHHHHCCCCCCCC	39.03	-
23	Pyrrolidone_carboxylic_acid	ISVVASAQSEAPAPS HHHHHHHCCCCCCCC	39.03	15322080
23	Pyrrolidone_carboxylic_acid	ISVVASAQSEAPAPS HHHHHHHCCCCCCCC	39.03	11006345
27	Hydroxylation	ASAQSEAPAPSPTSG HHHCCCCCCCCCCCC	40.42	15322080
27	O-linked_Glycosylation	ASAQSEAPAPSPTSG HHHCCCCCCCCCCCC	40.42	15322080
29	Hydroxylation	AQSEAPAPSPTSGSS HCCCCCCCCCCCCCC	39.52	15322080
29	O-linked_Glycosylation	AQSEAPAPSPTSGSS HCCCCCCCCCCCCCC	39.52	15322080
31	Hydroxylation	SEAPAPSPTSGSSAI CCCCCCCCCCCCCHH	29.53	15322080
31	O-linked_Glycosylation	SEAPAPSPTSGSSAI CCCCCCCCCCCCCHH	29.53	15322080
35	GPI-anchor	APSPTSGSSAISASF CCCCCCCCCHHHHHH	19.16	15322080

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of AGP15_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
27	P	Hydroxylation	Contains 4-hydroxyproline; hydroxylated on Pro-27, Pro-29 and Pro-31.	11006345
29	P	Hydroxylation	Contains 4-hydroxyproline; hydroxylated on Pro-27, Pro-29 and Pro-31.	11006345
31	P	Hydroxylation	Contains 4-hydroxyproline; hydroxylated on Pro-27, Pro-29 and Pro-31.	11006345

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of AGP15_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NAC89_ARATH	NAC089	physical	21798944

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.