UniProt ID | AGP15_ARATH | |
---|---|---|
UniProt AC | Q9LYF6 | |
Protein Name | Arabinogalactan protein 15 {ECO:0000303|PubMed:11006345} | |
Gene Name | AGP15 {ECO:0000303|PubMed:11006345} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 61 | |
Subcellular Localization |
Cell membrane Lipid-anchor, GPI-anchor . |
|
Protein Description | Proteoglycan that seems to be implicated in diverse developmental roles such as differentiation, cell-cell recognition, embryogenesis and programmed cell death.. | |
Protein Sequence | MAISKASIVVLMMVIISVVASAQSEAPAPSPTSGSSAISASFVSAGVAAVAALVFGSALRI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
23 | Pyrrolidone_carboxylic_acid | ISVVASAQSEAPAPS HHHHHHHCCCCCCCC | 39.03 | - | |
23 | Pyrrolidone_carboxylic_acid | ISVVASAQSEAPAPS HHHHHHHCCCCCCCC | 39.03 | 15322080 | |
23 | Pyrrolidone_carboxylic_acid | ISVVASAQSEAPAPS HHHHHHHCCCCCCCC | 39.03 | 11006345 | |
27 | Hydroxylation | ASAQSEAPAPSPTSG HHHCCCCCCCCCCCC | 40.42 | 15322080 | |
27 | O-linked_Glycosylation | ASAQSEAPAPSPTSG HHHCCCCCCCCCCCC | 40.42 | 15322080 | |
29 | Hydroxylation | AQSEAPAPSPTSGSS HCCCCCCCCCCCCCC | 39.52 | 15322080 | |
29 | O-linked_Glycosylation | AQSEAPAPSPTSGSS HCCCCCCCCCCCCCC | 39.52 | 15322080 | |
31 | Hydroxylation | SEAPAPSPTSGSSAI CCCCCCCCCCCCCHH | 29.53 | 15322080 | |
31 | O-linked_Glycosylation | SEAPAPSPTSGSSAI CCCCCCCCCCCCCHH | 29.53 | 15322080 | |
35 | GPI-anchor | APSPTSGSSAISASF CCCCCCCCCHHHHHH | 19.16 | 15322080 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AGP15_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AGP15_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NAC89_ARATH | NAC089 | physical | 21798944 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...