UniProt ID | AGP14_ARATH | |
---|---|---|
UniProt AC | Q9LVC0 | |
Protein Name | Arabinogalactan protein 14 {ECO:0000303|PubMed:11006345} | |
Gene Name | AGP14 {ECO:0000303|PubMed:11006345} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 60 | |
Subcellular Localization |
Cell membrane Lipid-anchor, GPI-anchor . |
|
Protein Description | Proteoglycan that seems to be implicated in diverse developmental roles such as differentiation, cell-cell recognition, embryogenesis and programmed cell death (Probable). Involved in the regulation of root hair elongation. [PubMed: 21248074] | |
Protein Sequence | MEAMKMKLYVVVLVAVIAFSTVHQTVAAVDAPAPSPTSDASSFIPTFFASVAVMAFGFFF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
32 | Hydroxylation | TVAAVDAPAPSPTSD HHHHHCCCCCCCCCC | 39.99 | 15322080 | |
32 | O-linked_Glycosylation | TVAAVDAPAPSPTSD HHHHHCCCCCCCCCC | 39.99 | 15322080 | |
34 | Hydroxylation | AAVDAPAPSPTSDAS HHHCCCCCCCCCCHH | 39.52 | 15322080 | |
34 | O-linked_Glycosylation | AAVDAPAPSPTSDAS HHHCCCCCCCCCCHH | 39.52 | 15322080 | |
36 | Hydroxylation | VDAPAPSPTSDASSF HCCCCCCCCCCHHHH | 34.56 | 15322080 | |
36 | O-linked_Glycosylation | VDAPAPSPTSDASSF HCCCCCCCCCCHHHH | 34.56 | 15322080 | |
38 | GPI-anchor | APAPSPTSDASSFIP CCCCCCCCCHHHHHH | 34.27 | 15322080 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AGP14_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AGP14_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of AGP14_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...