AGP14_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: AGP14_ARATH
• UniProt AC: Q9LVC0
• Protein Name: Arabinogalactan protein 14 {ECO:0000303|PubMed:11006345}
• Gene Name: AGP14 {ECO:0000303|PubMed:11006345}
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 60
• Subcellular Localization: Cell membrane ; Lipid-anchor, GPI-anchor .
• Protein Description: Proteoglycan that seems to be implicated in diverse developmental roles such as differentiation, cell-cell recognition, embryogenesis and programmed cell death (Probable). Involved in the regulation of root hair elongation. [PubMed: 21248074]
• Protein Sequence: MEAMKMKLYVVVLVAVIAFSTVHQTVAAVDAPAPSPTSDASSFIPTFFASVAVMAFGFFF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
32	Hydroxylation	TVAAVDAPAPSPTSD HHHHHCCCCCCCCCC	39.99	15322080
32	O-linked_Glycosylation	TVAAVDAPAPSPTSD HHHHHCCCCCCCCCC	39.99	15322080
34	Hydroxylation	AAVDAPAPSPTSDAS HHHCCCCCCCCCCHH	39.52	15322080
34	O-linked_Glycosylation	AAVDAPAPSPTSDAS HHHCCCCCCCCCCHH	39.52	15322080
36	Hydroxylation	VDAPAPSPTSDASSF HCCCCCCCCCCHHHH	34.56	15322080
36	O-linked_Glycosylation	VDAPAPSPTSDASSF HCCCCCCCCCCHHHH	34.56	15322080
38	GPI-anchor	APAPSPTSDASSFIP CCCCCCCCCHHHHHH	34.27	15322080

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of AGP14_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
32	P	Hydroxylation	Contains 4-hydroxyproline; hydroxylated on Pro-32, Pro-34 and Pro-36.	11006345
34	P	Hydroxylation	Contains 4-hydroxyproline; hydroxylated on Pro-32, Pro-34 and Pro-36.	11006345
36	P	Hydroxylation	Contains 4-hydroxyproline; hydroxylated on Pro-32, Pro-34 and Pro-36.	11006345

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of AGP14_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of AGP14_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.