dbPTM

AGP10_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	AGP10_ARATH
UniProt AC	Q9M0S4
Protein Name	Classical arabinogalactan protein 10
Gene Name	AGP10
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	127
Subcellular Localization	Cell membrane Lipid-anchor, GPI-anchor .
Protein Description	Proteoglycan that seems to be implicated in diverse developmental roles such as differentiation, cell-cell recognition, embryogenesis and programmed cell death..
Protein Sequence	MASKSVVVLLFLALIASSAIAQAPGPAPTRSPLPSPAQPPRTAAPTPSITPTPTPTPSATPTAAPVSPPAGSPLPSSASPPAPPTSLTPDGAPVAGPTGSTPVDNNNAATLAAGSLAGFVFVASLLL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
22	Pyrrolidone_carboxylic_acid	IASSAIAQAPGPAPT HHHHHHHCCCCCCCC	41.81	-
22	Pyrrolidone_carboxylic_acid	IASSAIAQAPGPAPT HHHHHHHCCCCCCCC	41.81	11006345
22	Pyrrolidone_carboxylic_acid	IASSAIAQAPGPAPT HHHHHHHCCCCCCCC	41.81	11006345
24	Hydroxylation	SSAIAQAPGPAPTRS HHHHHCCCCCCCCCC	36.90	11006345
24	O-linked_Glycosylation	SSAIAQAPGPAPTRS HHHHHCCCCCCCCCC	36.90	-
26	Hydroxylation	AIAQAPGPAPTRSPL HHHCCCCCCCCCCCC	33.72	11006345
26	O-linked_Glycosylation	AIAQAPGPAPTRSPL HHHCCCCCCCCCCCC	33.72	-
28	Hydroxylation	AQAPGPAPTRSPLPS HCCCCCCCCCCCCCC	31.32	11006345
28	O-linked_Glycosylation	AQAPGPAPTRSPLPS HCCCCCCCCCCCCCC	31.32	-
32	Hydroxylation	GPAPTRSPLPSPAQP CCCCCCCCCCCCCCC	45.03	11006345
32	O-linked_Glycosylation	GPAPTRSPLPSPAQP CCCCCCCCCCCCCCC	45.03	-
36	Hydroxylation	TRSPLPSPAQPPRTA CCCCCCCCCCCCCCC	32.73	11006345
36	O-linked_Glycosylation	TRSPLPSPAQPPRTA CCCCCCCCCCCCCCC	32.73	-
107	GPI-anchor	STPVDNNNAATLAAG CCCCCCCHHHHHHHH	36.89	11006345

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of AGP10_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of AGP10_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of AGP10_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of AGP10_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of AGP10_ARATH

Related Literatures of Post-Translational Modification

GPI-anchor
Reference	PubMed
"The classical arabinogalactan protein gene family of Arabidopsis."; Schultz C.J., Johnson K.L., Currie G., Bacic A.; Plant Cell 12:1751-1767(2000). Cited for: NUCLEOTIDE SEQUENCE [MRNA], PROTEIN SEQUENCE OF 22-37, TISSUESPECIFICITY, MASS SPECTROMETRY, GLYCOSYLATION, AND GPI-ANCHOR.	11006345 [Abstract]