AGL62_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: AGL62_ARATH
• UniProt AC: Q9FKK2
• Protein Name: Agamous-like MADS-box protein AGL62
• Gene Name: AGL62
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 299
• Subcellular Localization: Nucleus.
• Protein Description: Probable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development..
• Protein Sequence: MVKKSKGRQKIEMVKMKNESNLQVTFSKRRSGLFKKASELCTLCGAEVAIVVFSPGRKVFSFGHPNVDSVIDRFINNNPLPPHQHNNMQLRETRRNSIVQDLNNHLTQVLSQLETEKKKYDELKKIREKTKALGNWWEDPVEELALSQLEGFKGNLENLKKVVTVEASRFFQANVPNFYVGSSSNNAAFGIDDGSHINPDMDLFSQRRMMDINAFNYNQNQIHPNHALPPFGNNAYGINEGFVPEYNVNFRPEYNPNQNQIQNQNQVQIQIQNQSFKRENISEYEHHHGYPPQSRSDYY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of AGL62_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of AGL62_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of AGL62_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of AGL62_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PHE1_ARATH	PHE1	physical	15805477
PHE2_ARATH	AGL38	physical	15805477
AGL90_ARATH	AGL90	physical	15805477

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.