AFP4_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: AFP4_ARATH
• UniProt AC: Q9S7Z2
• Protein Name: Ninja-family protein AFP4
• Gene Name: AFP4
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 319
• Subcellular Localization: Nucleus .
• Protein Description: Acts as a negative regulator of abscisic acid (ABA) and salinity responses..
• Protein Sequence: MEMIRGRGIPNGVVQVPNLSANNLLQKFFIASNHFCQRDSEHGENQQEAKKREDEAEEDEKDVELTLGLSLNGQFGTDPRSRKRRHFELGRSSSIPEGFVFDEQRSGGGNGGDMRRIVGRGGSDMFQLDRTRSLPVVTEMDIEKERKVSEKTRAFMESPVTNRGAYLTKDKNRGQAVETEKPRAFLEFKIPPTKEGKKEKDRLVVTGPVNGKGKNGNTAKKQKNNVENSGMEKARNILEDMPCVSTRDVGADGKRVEGFLYWYGGNKEEVKIVCVCHGSFLSPAEFVRHGGGTVSDDDGGDVMINPLRHIVVKLPSSSI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
94	Phosphorylation	FELGRSSSIPEGFVF CCCCCCCCCCCCEEE	43.33	29797451
133	Phosphorylation	FQLDRTRSLPVVTEM EECCCCCCCCEEEEC	36.09	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of AFP4_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of AFP4_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of AFP4_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ABI5_ARATH	ABI5	physical	24823379
P2C78_ARATH	HAI1	physical	24823379

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.