ADRM1_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ADRM1_RAT
• UniProt AC: Q9JMB5
• Protein Name: Proteasomal ubiquitin receptor ADRM1
• Gene Name: Adrm1
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 407
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair. Within the complex, functions as a proteasomal ubiquitin receptor. Engages and thus activates 19S-associated deubiquitinases UCHL5 and PSMD14 during protein degradation. UCHL5 reversibly associate with the 19S regulatory particle whereas PSMD14 is an intrinsic subunit of the proteasome lid subcomplex..
• Protein Sequence: MTTSGALFPSLVPGSRGSSTKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGTVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNECLNNPPMPGTLGASGSSGHELSALGGEGGLQSLLGNMSHSQLMQLIGPAGLGGLGGLGALTGPGLASLLGSSGPPASSSSSSSRSQSAAVTPSSTTSSARATPAPSAPAAASATSPSPAPSSGNGTSTAASPTQPIQLSDLQSILATMNVPAGPGGSQQVDLASVLTPEIMAPILANADVQERLLPYLPSGESLPQTAEEIQNTLTSPQFQQALGMFSAALASGQLGPLMCQFGLPAEAVEAANKGDVEAFAKAMQNNAKSDPKEGDTKDKKDEEEDMSLD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MTTSGALFP ------CCCCCCCCC	29.66	-
15	Phosphorylation	FPSLVPGSRGSSTKY CCCCCCCCCCCCCEE	27.65	23984901
18	Phosphorylation	LVPGSRGSSTKYLVE CCCCCCCCCCEEEEE	33.45	23984901
19	Phosphorylation	VPGSRGSSTKYLVEF CCCCCCCCCEEEEEE	31.57	23984901
20	Phosphorylation	PGSRGSSTKYLVEFR CCCCCCCCEEEEEEE	25.96	23984901
21	Ubiquitination	GSRGSSTKYLVEFRA CCCCCCCEEEEEEEC	38.24	-
34	Ubiquitination	RAGKMSLKGTTVTPD ECCCCEEECEEECCC	47.07	-
140	Phosphorylation	MPGTLGASGSSGHEL CCCCCCCCCCCCCHH	37.09	-
211	Phosphorylation	SSSSSSRSQSAAVTP CCCCCCCCCCCCCCC	30.36	28432305
213	Phosphorylation	SSSSRSQSAAVTPSS CCCCCCCCCCCCCCC	21.31	27097102
217	Phosphorylation	RSQSAAVTPSSTTSS CCCCCCCCCCCCCCC	16.84	27097102
219	Phosphorylation	QSAAVTPSSTTSSAR CCCCCCCCCCCCCCC	30.83	27097102
220	Phosphorylation	SAAVTPSSTTSSARA CCCCCCCCCCCCCCC	36.59	27097102
221	Phosphorylation	AAVTPSSTTSSARAT CCCCCCCCCCCCCCC	34.73	27097102
222	Phosphorylation	AVTPSSTTSSARATP CCCCCCCCCCCCCCC	23.72	27097102
223	Phosphorylation	VTPSSTTSSARATPA CCCCCCCCCCCCCCC	23.30	27097102
224	Phosphorylation	TPSSTTSSARATPAP CCCCCCCCCCCCCCC	21.49	27097102
397	Acetylation	KEGDTKDKKDEEEDM CCCCCCCCHHHHHHC	64.78	22902405
405	Phosphorylation	KDEEEDMSLD----- HHHHHHCCCC-----	41.53	29779826

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ADRM1_RAT !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ADRM1_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ADRM1_RAT !!

Protein-Protein Interaction

Oops, there are no PPI records of ADRM1_RAT !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.