ADPRM_ARATH - dbPTM
ADPRM_ARATH - PTM Information in dbPTM
Basic Information of Protein
UniProt ID ADPRM_ARATH
UniProt AC Q9SB68
Protein Name Manganese-dependent ADP-ribose/CDP-alcohol diphosphatase
Gene Name At4g24730
Organism Arabidopsis thaliana (Mouse-ear cress).
Sequence Length 311
Subcellular Localization
Protein Description Hydrolyzes ADP-ribose, IDP-ribose, CDP-glycerol, CDP-choline and CDP-ethanolamine, but not other non-reducing ADP-sugars or CDP-glucose..
Protein Sequence MGSAARQPLFSFGVIADVQYADISDGRSFLGVPRYYRNSILVLQRAVETWNQHGNLKFVINMGDIVDGFCPKDQSLAATKKLVHEFEKFNGPVYHMIGNHCLYNLPREELLPLLKIPGRDGNAYYDFSPTPEYRVVVLDGYDISAVGWPQEHPNTIAALKILEEKNPNTDKNSPAGLEDVARRFVKYNGGVGEKQLQWLDSVLQDASNSNQRVIVCGHVPMSPGVASKAALLWNFDEVMNIIHKYDSVKVCLSGHDHKGGYFVDSHGVHHRSLEAALECPPGTYSFGYIDVYDNKLSLVGTDRMQSTDFEN
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster

Oops, there are no PTM records of ADPRM_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)
Modified Location Modified Residue Modification Type of Upstream Proteins Gene Name of Upstream Proteins UniProt AC of Upstream Proteins Sources

Oops, there are no upstream regulatory protein records of ADPRM_ARATH !!

Functions of PTM Sites
Modified Location Modified Residue Modification Function Reference

Oops, there are no descriptions of PTM sites of ADPRM_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of ADPRM_ARATH !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions

Oops, there are no PPI records of ADPRM_ARATH !!

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Regulatory Network of ADPRM_ARATH

loading...

Related Literatures of Post-Translational Modification

TOP