ADM2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ADM2_HUMAN
• UniProt AC: Q7Z4H4
• Protein Name: ADM2
• Gene Name: ADM2
• Organism: Homo sapiens (Human).
• Sequence Length: 148
• Subcellular Localization: Secreted.
• Protein Description: IMDL and IMDS may play a role as physiological regulators of gastrointestinal, cardiovascular bioactivities mediated by the CALCRL/RAMPs receptor complexes. Activates the cAMP-dependent pathway..
• Protein Sequence: MARIPTAALGCISLLCLQLPGSLSRSLGGDPRPVKPREPPARSPSSSLQPRHPAPRPVVWKLHRALQAQRGAGLAPVMGQPLRDGGRQHSGPRRHSGPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSYG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
43	Phosphorylation	PREPPARSPSSSLQP CCCCCCCCCCCCCCC	31.10	30576142
45	Phosphorylation	EPPARSPSSSLQPRH CCCCCCCCCCCCCCC	33.53	30576142
46	Phosphorylation	PPARSPSSSLQPRHP CCCCCCCCCCCCCCC	38.15	30576142
121	Phosphorylation	TCQVQNLSHRLWQLM HHHHHCHHHHHHHHH	17.70	19369195
147	Tyrosine amide	DPSSPHSYG------ CCCCCCCCC------	24.66	-
147	Amidation	DPSSPHSYG------ CCCCCCCCC------	24.66	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ADM2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ADM2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ADM2_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of ADM2_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.