UniProt ID | ADM2_HUMAN | |
---|---|---|
UniProt AC | Q7Z4H4 | |
Protein Name | ADM2 | |
Gene Name | ADM2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 148 | |
Subcellular Localization | Secreted. | |
Protein Description | IMDL and IMDS may play a role as physiological regulators of gastrointestinal, cardiovascular bioactivities mediated by the CALCRL/RAMPs receptor complexes. Activates the cAMP-dependent pathway.. | |
Protein Sequence | MARIPTAALGCISLLCLQLPGSLSRSLGGDPRPVKPREPPARSPSSSLQPRHPAPRPVVWKLHRALQAQRGAGLAPVMGQPLRDGGRQHSGPRRHSGPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSYG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
43 | Phosphorylation | PREPPARSPSSSLQP CCCCCCCCCCCCCCC | 31.10 | 30576142 | |
45 | Phosphorylation | EPPARSPSSSLQPRH CCCCCCCCCCCCCCC | 33.53 | 30576142 | |
46 | Phosphorylation | PPARSPSSSLQPRHP CCCCCCCCCCCCCCC | 38.15 | 30576142 | |
121 | Phosphorylation | TCQVQNLSHRLWQLM HHHHHCHHHHHHHHH | 17.70 | 19369195 | |
147 | Tyrosine amide | DPSSPHSYG------ CCCCCCCCC------ | 24.66 | - | |
147 | Amidation | DPSSPHSYG------ CCCCCCCCC------ | 24.66 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ADM2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ADM2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ADM2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ADM2_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...