| UniProt ID | ADIRF_HUMAN | |
|---|---|---|
| UniProt AC | Q15847 | |
| Protein Name | Adipogenesis regulatory factor | |
| Gene Name | ADIRF | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 76 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Plays a role in fat cell development; promotes adipogenic differentiation and stimulates transcription initiation of master adipogenesis factors like PPARG and CEBPA at early stages of preadipocyte differentiation. Its overexpression confers resistance to the anticancer chemotherapeutic drug cisplatin.. | |
| Protein Sequence | MASKGLQDLKQQVEGTAQEAVSAAGAAAQQVVDQATEAGQKAMDQLAKTTQETIDKTANQASDTFSGIGKKFGLLK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | Phosphorylation | -----MASKGLQDLK -----CCCCHHHHHH | 25394399 | ||
| 22 | Phosphorylation | GTAQEAVSAAGAAAQ HHHHHHHHHHHHHHH | 113317661 | ||
| 36 | Phosphorylation | QQVVDQATEAGQKAM HHHHHHHHHHHHHHH | 18452278 | ||
| 48 | Ubiquitination | KAMDQLAKTTQETID HHHHHHHHHHHHHHH | 21906983 | ||
| 50 | Phosphorylation | MDQLAKTTQETIDKT HHHHHHHHHHHHHHH | 54887601 | ||
| 53 | Phosphorylation | LAKTTQETIDKTANQ HHHHHHHHHHHHHHH | 28348404 | ||
| 56 | Ubiquitination | TTQETIDKTANQASD HHHHHHHHHHHHHHH | 21906983 | ||
| 57 | O-linked_Glycosylation | TQETIDKTANQASDT HHHHHHHHHHHHHHH | 55829369 | ||
| 57 | Phosphorylation | TQETIDKTANQASDT HHHHHHHHHHHHHHH | 27251275 | ||
| 62 | Phosphorylation | DKTANQASDTFSGIG HHHHHHHHHHCCCHH | 23312004 | ||
| 64 | Phosphorylation | TANQASDTFSGIGKK HHHHHHHHCCCHHHH | 23312004 | ||
| 66 | Phosphorylation | NQASDTFSGIGKKFG HHHHHHCCCHHHHHC | 25056879 | ||
| 70 | Acetylation | DTFSGIGKKFGLLK- HHCCCHHHHHCCCC- | 26051181 | ||
| 70 | Ubiquitination | DTFSGIGKKFGLLK- HHCCCHHHHHCCCC- | 21906983 | ||
| 71 | Acetylation | TFSGIGKKFGLLK-- HCCCHHHHHCCCC-- | 7338391 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ADIRF_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ADIRF_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ADIRF_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of ADIRF_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
