dbPTM

ACY1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ACY1_MOUSE
UniProt AC	Q99JW2
Protein Name	Aminoacylase-1
Gene Name	Acy1
Organism	Mus musculus (Mouse).
Sequence Length	408
Subcellular Localization	Cytoplasm.
Protein Description	Involved in the hydrolysis of N-acylated or N-acetylated amino acids (except L-aspartate)..
Protein Sequence	MTTKDPESEHPSVTLFRQYLRICTVQPNPDYGGAITFLEERARQLGLSCQKIEVVPGFVITVLTWPGTNPSLPSILLNSHTDVVPVFKEHWHHDPFEAFKDSEGYIYARGSQDMKSVSIQYLEAVRRLKSEGHRFPRTIHMTFVPDEEVGGHKGMELFVKRPEFQALRAGFALDEGLANPTDAFTVFYSERSPWWVRVTSTGKPGHASRFIEDTAAEKLHKVISSILAFREKERQRLQANPHLKEGAVTSVNLTKLEGGVAYNVVPATMSASFDFRVAPDVDMKAFEKQLQRWCQEAGEGVTFEFAQKFTEPRMTPTDDSDPWWAAFSGACKAMNLTLEPEIFPAATDSRYIRAVGIPALGFSPMNRTPVLLHDHNERLHEDIFLRGVDIYTGLLSALASVPTLPGES

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Ubiquitination	----MTTKDPESEHP ----CCCCCCCCCCC	63.22	22790023
107	Phosphorylation	KDSEGYIYARGSQDM CCCCCEEEEECCCCC	5.03	25195567
114	Sulfoxidation	YARGSQDMKSVSIQY EEECCCCCHHCHHHH	2.43	21406390
250	Phosphorylation	LKEGAVTSVNLTKLE CCCCCEEEEECEEEE	11.47	28059163
284	Ubiquitination	VAPDVDMKAFEKQLQ ECCCCCHHHHHHHHH	45.52	22790023
284	Malonylation	VAPDVDMKAFEKQLQ ECCCCCHHHHHHHHH	45.52	32601280
288	Acetylation	VDMKAFEKQLQRWCQ CCHHHHHHHHHHHHH	50.26	23954790
288	Ubiquitination	VDMKAFEKQLQRWCQ CCHHHHHHHHHHHHH	50.26	-
288	Malonylation	VDMKAFEKQLQRWCQ CCHHHHHHHHHHHHH	50.26	26320211

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ACY1_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ACY1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ACY1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of ACY1_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ACY1_MOUSE

Related Literatures of Post-Translational Modification