dbPTM

ACY1A_RAT - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ACY1A_RAT
UniProt AC	Q6AYS7
Protein Name	Aminoacylase-1A
Gene Name	Acy1a
Organism	Rattus norvegicus (Rat).
Sequence Length	408
Subcellular Localization	Cytoplasm.
Protein Description	Involved in the hydrolysis of N-acylated or N-acetylated amino acids (except L-aspartate)..
Protein Sequence	MTTKGPESEHPSVTLFRQYLRICTVQPNPDYGSAVTFLEERARQLGLSCQKIEVAPGYVITVLTWPGTNPLLHSILLNSHTDVVPVFKEHWHHDPFEAFKDSEGYIYARGAQDMKSVSIQYLEAVRRLKSEGHRFPRTIHMTFVPDEEVGGHKGMELFVKRPEFQALRAGFALDEGLANPTDAFTVFYSERSPWWIRVTSTGKPGHASRFIEDTAAEKLHKVVNSILAFREKERQRLQANPHLKEGAVTSVNLTKLEGGVAYNVVPATMSACFDFRVAPDVDMKAFEKQLQSWCQEAGEGVTFEFAQKFTEPRMTPTDDTDPWWAAFSGACKEMNLTLEPEIFPAATDSRYIRAVGIPALGFSPMNRTPVLLHDHNERLHEAVFLRGVDIYTRLVAALASVPALPGES

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Acetylation	----MTTKGPESEHP ----CCCCCCCCCCC	64.40	22902405
153	Acetylation	DEEVGGHKGMELFVK CCCCCCCCCCEEEEC	64.33	22902405
160	Acetylation	KGMELFVKRPEFQAL CCCEEEECCHHHHHH	55.70	22902405
218	Acetylation	IEDTAAEKLHKVVNS CHHHHHHHHHHHHHH	51.68	22902405
221	Acetylation	TAAEKLHKVVNSILA HHHHHHHHHHHHHHH	59.31	22902405
232	Acetylation	SILAFREKERQRLQA HHHHHHHHHHHHHHC	54.67	22902405
244	Acetylation	LQANPHLKEGAVTSV HHCCCCCCCCCEEEE	51.58	22902405
284	Acetylation	VAPDVDMKAFEKQLQ ECCCCCHHHHHHHHH	45.52	22902405
400	Phosphorylation	RLVAALASVPALPGE HHHHHHHCCCCCCCC	29.50	28689409
408	Phosphorylation	VPALPGES------- CCCCCCCC-------	51.98	22673903

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ACY1A_RAT !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ACY1A_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ACY1A_RAT !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of ACY1A_RAT !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ACY1A_RAT

Related Literatures of Post-Translational Modification