dbPTM

ACTZ_RAT - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ACTZ_RAT
UniProt AC	P85515
Protein Name	Alpha-centractin
Gene Name	Actr1a {ECO:0000250\|UniProtKB:P61163}
Organism	Rattus norvegicus (Rat).
Sequence Length	376
Subcellular Localization	Cytoplasm, cytoskeleton . Cytoplasm, cytoskeleton, microtubule organizing center, centrosome . Cytoplasm, cell cortex .
Protein Description	Component of a multi-subunit complex involved in microtubule based vesicle motility. It is associated with the centrosome (By similarity)..
Protein Sequence	MESYDVIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKTF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MESYDVIA -------CCCCCEEC	7.52	-
301	Phosphorylation	LFSNIVLSGGSTLFK HHHCEEECCCCHHHC	30.16	23984901
304	Phosphorylation	NIVLSGGSTLFKGFG CEEECCCCHHHCCHH	26.01	23984901
305	Phosphorylation	IVLSGGSTLFKGFGD EEECCCCHHHCCHHH	39.22	23984901
308	Ubiquitination	SGGSTLFKGFGDRLL CCCCHHHCCHHHHHH	57.34	-
338	Phosphorylation	SAPQERLYSTWIGGS ECCHHHHHCCCHHHH	15.41	31136905
361	Acetylation	KKMWVSKKEYEEDGA HHHHCCHHHHCCCCC	59.01	22902405

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ACTZ_RAT !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ACTZ_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ACTZ_RAT !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of ACTZ_RAT !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ACTZ_RAT

Related Literatures of Post-Translational Modification