| UniProt ID | ACTH_CHICK | |
|---|---|---|
| UniProt AC | P63270 | |
| Protein Name | Actin, gamma-enteric smooth muscle | |
| Gene Name | ACTG2 | |
| Organism | Gallus gallus (Chicken). | |
| Sequence Length | 376 | |
| Subcellular Localization | Cytoplasm, cytoskeleton. | |
| Protein Description | Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.. | |
| Protein Sequence | MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MCEEETTAL ------CCCCCCEEE | 10.16 | - | |
| 3 | Acetylation | -----MCEEETTALV -----CCCCCCEEEE | 58.53 | - | |
| 45 | Oxidation | RPRHQGVMVGMGQKD CCCCCCEEEECCCCC | 2.49 | - | |
| 48 | Oxidation | HQGVMVGMGQKDSYV CCCEEEECCCCCCCC | 3.32 | - | |
| 74 | Methylation | TLKYPIEHGIITNWD EEECEECCCCCCCHH | 33.21 | - | |
| 85 | Methylation | TNWDDMEKIWHHSFY CCHHHHHHHHHHHHH | 44.45 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ACTH_CHICK !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ACTH_CHICK !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ACTH_CHICK !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of ACTH_CHICK !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...