UniProt ID | ACTH_CHICK | |
---|---|---|
UniProt AC | P63270 | |
Protein Name | Actin, gamma-enteric smooth muscle | |
Gene Name | ACTG2 | |
Organism | Gallus gallus (Chicken). | |
Sequence Length | 376 | |
Subcellular Localization | Cytoplasm, cytoskeleton. | |
Protein Description | Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.. | |
Protein Sequence | MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MCEEETTAL ------CCCCCCEEE | 10.16 | - | |
3 | Acetylation | -----MCEEETTALV -----CCCCCCEEEE | 58.53 | - | |
45 | Oxidation | RPRHQGVMVGMGQKD CCCCCCEEEECCCCC | 2.49 | - | |
48 | Oxidation | HQGVMVGMGQKDSYV CCCEEEECCCCCCCC | 3.32 | - | |
74 | Methylation | TLKYPIEHGIITNWD EEECEECCCCCCCHH | 33.21 | - | |
85 | Methylation | TNWDDMEKIWHHSFY CCHHHHHHHHHHHHH | 44.45 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ACTH_CHICK !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ACTH_CHICK !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ACTH_CHICK !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ACTH_CHICK !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...