| UniProt ID | ACT8_ARATH | |
|---|---|---|
| UniProt AC | Q96293 | |
| Protein Name | Actin-8 | |
| Gene Name | ACT8 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 377 | |
| Subcellular Localization | Cytoplasm, cytoskeleton. | |
| Protein Description | Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. Essential component of cell cytoskeleton; plays an important role in cytoplasmic streaming, cell shape determination, cell division, organelle movement and extension growth. This is considered as one of the vegetative actins.. | |
| Protein Sequence | MADADDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHHGVMVGMNQKDAYVGDEAQSKRGILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGFSLPHAILRLDLAGRDLTDYLMKILTERGYMFTTTAEREIVRDIKEKLSFVAVDYEQEMETSKTSSSIEKNYELPDGQVITIGAERFRCPEVLFQPSFVGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFSGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKAEYDEAGPGIVHRKCF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MADADDIQP ------CCCHHHCCC | 22.24 | - | |
| 62 | Phosphorylation | YVGDEAQSKRGILTL CCCCHHHHCCCEEEE | 31.22 | 30407730 | |
| 143 | Phosphorylation | VAIQAVLSLYASGRT HHHHHHHHHHHCCCC | 16.85 | 29797451 | |
| 325 | Phosphorylation | EITALAPSSMKIKVV HHHHCCCCCCEEEEE | 37.14 | 25561503 | |
| 326 | Phosphorylation | ITALAPSSMKIKVVA HHHCCCCCCEEEEEC | 24.04 | 25561503 | |
| 327 | Sulfoxidation | TALAPSSMKIKVVAP HHCCCCCCEEEEECC | 6.45 | 25693801 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ACT8_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ACT8_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ACT8_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of ACT8_ARATH !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
