UniProt ID | ACPM_SCHPO | |
---|---|---|
UniProt AC | Q10217 | |
Protein Name | Putative acyl carrier protein, mitochondrial | |
Gene Name | SPAC4H3.09 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 112 | |
Subcellular Localization | Mitochondrion. | |
Protein Description | Carrier of the growing fatty acid chain in fatty acid biosynthesis (By similarity). May be involved in the synthesis of very-long-chain fatty acids.. | |
Protein Sequence | MLSRFSSQLRFISAVRPVIPKFQPLRFYSVARPDAEKRILKVVSSFDKIQDPKKVTPTSTFANDLGLDSLDAVEVVMAIEEEFSIQIPDKDADEITSVGDAISYITKNPEAK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
44 | Phosphorylation | KRILKVVSSFDKIQD HHHHHHHHHCCCCCC | 28.42 | 25720772 | |
45 | Phosphorylation | RILKVVSSFDKIQDP HHHHHHHHCCCCCCC | 26.34 | 25720772 | |
69 | O-(pantetheine 4'-phosphoryl)serine | ANDLGLDSLDAVEVV CCCCCCCCCCHHHHH | 32.94 | - | |
69 | Phosphorylation | ANDLGLDSLDAVEVV CCCCCCCCCCHHHHH | 32.94 | - | |
103 | Phosphorylation | TSVGDAISYITKNPE CCHHHHHHHHHCCCC | 16.53 | 24763107 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ACPM_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ACPM_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ACPM_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ACPM_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...