UniProt ID | ACPM2_ARATH | |
---|---|---|
UniProt AC | O80800 | |
Protein Name | Acyl carrier protein 2, mitochondrial | |
Gene Name | MTACP2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 126 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | Carrier of the growing fatty acid chain in fatty acid biosynthesis (By similarity). May be involved in the synthesis of short and medium chain fatty acids. Accessory and non-catalytic subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain (By similarity).. | |
Protein Sequence | MAARGAMLRYLRVNVNPTIQNPRECVLPFSILLRRFSEEVRGSFLDKSEVTDRVLSVVKNFQKVDPSKVTPKANFQNDLGLDSLDSVEVVMALEEEFGFEIPDNEADKIQSIDLAVDFIASHPQAK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
63 | Acetylation | SVVKNFQKVDPSKVT HHHHHHCCCCHHHCC | 44.46 | 24727099 | |
83 | O-(pantetheine 4'-phosphoryl)serine | QNDLGLDSLDSVEVV CCCCCCCCCCCHHHH | 38.83 | - | |
83 | Phosphorylation | QNDLGLDSLDSVEVV CCCCCCCCCCCHHHH | 38.83 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ACPM2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ACPM2_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ACPM2_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ACPM2_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...