UniProt ID | ACHA5_HUMAN | |
---|---|---|
UniProt AC | P30532 | |
Protein Name | Neuronal acetylcholine receptor subunit alpha-5 | |
Gene Name | CHRNA5 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 468 | |
Subcellular Localization |
Cell junction, synapse, postsynaptic cell membrane Multi-pass membrane protein. Cell membrane Multi-pass membrane protein. |
|
Protein Description | After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.. | |
Protein Sequence | MAARGSGPRALRLLLLVQLVAGRCGLAGAAGGAQRGLSEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTPDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYSFVIKRLPLFYTLFLIIPCIGLSFLTVLVFYLPSNEGEKICLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLVFTMIFVTLSIMVTVFAINIHHRSSSTHNAMAPLVRKIFLHTLPKLLCMRSHVDRYFTQKEETESGSGPKSSRNTLEAALDSIRYITRHIMKENDVREVVEDWKFIAQVLDRMFLWTFLFVSIVGSLGLFVPVIYKWANILIPVHIGNANK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
45 | Ubiquitination | SEPSSIAKHEDSLLK CCCCHHHHCCHHHHH | 45.95 | - | |
49 | Phosphorylation | SIAKHEDSLLKDLFQ HHHHCCHHHHHHHHH | 32.39 | 24719451 | |
52 | Ubiquitination | KHEDSLLKDLFQDYE HCCHHHHHHHHHHHH | 58.65 | 21906983 | |
71 | Ubiquitination | PVEHLNDKIKIKFGL CHHHHCHHHHHCHHE | 44.84 | - | |
94 | Phosphorylation | DEKNQLMTTNVWLKQ CHHCCEEEEEEEEEE | 24.66 | 30266825 | |
95 | Phosphorylation | EKNQLMTTNVWLKQE HHCCEEEEEEEEEEC | 17.51 | 30266825 | |
100 | Ubiquitination | MTTNVWLKQEWIDVK EEEEEEEEECEEEEE | 30.38 | - | |
107 | Ubiquitination | KQEWIDVKLRWNPDD EECEEEEEECCCCCC | 28.69 | 21906983 | |
119 | Ubiquitination | PDDYGGIKVIRVPSD CCCCCCEEEEEECCC | 34.58 | 21890473 | |
147 | Phosphorylation | DGRFEGTSTKTVIRY CCCEECCCCCEEEEE | 38.47 | - | |
148 | Phosphorylation | GRFEGTSTKTVIRYN CCEECCCCCEEEEEC | 30.49 | - | |
149 | Ubiquitination | RFEGTSTKTVIRYNG CEECCCCCEEEEECC | 40.33 | 21906983 | |
150 | Phosphorylation | FEGTSTKTVIRYNGT EECCCCCEEEEECCE | 22.66 | - | |
155 | N-linked_Glycosylation | TKTVIRYNGTVTWTP CCEEEEECCEEEECC | 29.79 | UniProtKB CARBOHYD | |
183 | N-linked_Glycosylation | FFPFDLQNCSMKFGS EECCCCCCCEEEECE | 27.42 | UniProtKB CARBOHYD | |
209 | Ubiquitination | LEDQDVDKRDFFDNG ECCCCCCHHHCCCCC | 54.43 | - | |
227 | Ubiquitination | IVSATGSKGNRTDSC EEEEECCCCCCCCCC | 62.64 | 21890473 | |
229 | N-linked_Glycosylation | SATGSKGNRTDSCCW EEECCCCCCCCCCCC | 47.63 | UniProtKB CARBOHYD | |
354 | Ubiquitination | AMAPLVRKIFLHTLP CHHHHHHHHHHHHHH | 30.26 | - | |
373 | Phosphorylation | MRSHVDRYFTQKEET HHHHHHHHCCCHHHC | 13.40 | - | |
377 | Ubiquitination | VDRYFTQKEETESGS HHHHCCCHHHCCCCC | 55.23 | 21906983 | |
387 | Ubiquitination | TESGSGPKSSRNTLE CCCCCCCCCHHHHHH | 65.67 | 21906983 | |
409 | Ubiquitination | YITRHIMKENDVREV HHHHHHHHHCCHHHH | 53.41 | 2190698 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ACHA5_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ACHA5_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ACHA5_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ACHA5_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
D00611 | Mecamylamine hydrochloride (USP); Inversine (TN) | |||||
D00999 | Acetylcholine chloride (JP16/USP/INN); Miochol (TN) | |||||
D02202 | Lobeline hydrochloride (JAN) | |||||
D02204 | Hexamethonium bromide (JAN/INN); Hexamethonium bromide (TN) | |||||
D02364 | Lobeline (INN) | |||||
D08138 | Lobeline sulfate; Smokeless (TN) | |||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...