ACCO4_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ACCO4_ARATH
• UniProt AC: Q06588
• Protein Name: 1-aminocyclopropane-1-carboxylate oxidase 4
• Gene Name: ACO4
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 323
• Protein Description: Enzyme involved in the ethylene biosynthesis. May promote stem elongation by maximizing the extensibility cells, possibly by activating ethylene biosynthesis, in response to very-long-chain fatty acids (VLCFAs C20:0 to C30:0)..
• Protein Sequence: MESFPIINLEKLNGEERAITMEKIKDACENWGFFECVNHGISLELLDKVEKMTKEHYKKCMEERFKESIKNRGLDSLRSEVNDVDWESTFYLKHLPVSNISDVPDLDDDYRTLMKDFAGKIEKLSEELLDLLCENLGLEKGYLKKVFYGSKRPTFGTKVSNYPPCPNPDLVKGLRAHTDAGGIILLFQDDKVSGLQLLKDGEWVDVPPVKHSIVVNLGDQLEVITNGKYKSVEHRVLSQTDGEGRMSIASFYNPGSDSVIFPAPELIGKEAEKEKKENYPRFVFEDYMKLYSAVKFQAKEPRFEAMKAMETTVANNVGPLATA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MESFPIIN -------CCCCCEEE	9.81	22223895
21	Sulfoxidation	GEERAITMEKIKDAC CCEEEECHHHHHHHH	3.95	25693801
306	Sulfoxidation	KEPRFEAMKAMETTV CCCCHHHHHHHHHHH	1.93	25693801
309	Sulfoxidation	RFEAMKAMETTVANN CHHHHHHHHHHHHHC	3.82	25693801

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ACCO4_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ACCO4_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ACCO4_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of ACCO4_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.