UniProt ID | ACBP_RAT | |
---|---|---|
UniProt AC | P11030 | |
Protein Name | Acyl-CoA-binding protein | |
Gene Name | Dbi | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 87 | |
Subcellular Localization | Endoplasmic reticulum . Golgi apparatus . Golgi localization is dependent on ligand binding. | |
Protein Description | Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor.. | |
Protein Sequence | MSQADFDKAAEEVKRLKTQPTDEEMLFIYSHFKQATVGDVNTDRPGLLDLKGKAKWDSWNKLKGTSKENAMKTYVEKVEELKKKYGI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSQADFDKA ------CCHHHHHHH | 33.79 | 18455725 | |
2 | Acetylation | ------MSQADFDKA ------CCHHHHHHH | 33.79 | 2803267 | |
8 | Succinylation | MSQADFDKAAEEVKR CCHHHHHHHHHHHHH | 49.87 | - | |
8 | Succinylation | MSQADFDKAAEEVKR CCHHHHHHHHHHHHH | 49.87 | - | |
8 | Acetylation | MSQADFDKAAEEVKR CCHHHHHHHHHHHHH | 49.87 | 22902405 | |
14 | Acetylation | DKAAEEVKRLKTQPT HHHHHHHHHHCCCCC | 56.12 | 22902405 | |
17 | Acetylation | AEEVKRLKTQPTDEE HHHHHHHCCCCCCHH | 49.50 | 22902405 | |
17 | Succinylation | AEEVKRLKTQPTDEE HHHHHHHCCCCCCHH | 49.50 | - | |
17 | Succinylation | AEEVKRLKTQPTDEE HHHHHHHCCCCCCHH | 49.50 | - | |
29 | Phosphorylation | DEEMLFIYSHFKQAT CHHHHHHHHHHCCCC | 6.69 | 22108457 | |
30 | Phosphorylation | EEMLFIYSHFKQATV HHHHHHHHHHCCCCC | 20.03 | 25403869 | |
33 | Acetylation | LFIYSHFKQATVGDV HHHHHHHCCCCCCCC | 33.33 | 22902405 | |
51 | Acetylation | RPGLLDLKGKAKWDS CCCCCCCCCCCCHHC | 59.02 | 25786129 | |
51 | Ubiquitination | RPGLLDLKGKAKWDS CCCCCCCCCCCCHHC | 59.02 | - | |
53 | Acetylation | GLLDLKGKAKWDSWN CCCCCCCCCCHHCHH | 45.25 | 22902405 | |
55 | N6-malonyllysine | LDLKGKAKWDSWNKL CCCCCCCCHHCHHHC | 55.83 | - | |
55 | Malonylation | LDLKGKAKWDSWNKL CCCCCCCCHHCHHHC | 55.83 | - | |
55 | Succinylation | LDLKGKAKWDSWNKL CCCCCCCCHHCHHHC | 55.83 | - | |
55 | Acetylation | LDLKGKAKWDSWNKL CCCCCCCCHHCHHHC | 55.83 | 25786129 | |
58 | Phosphorylation | KGKAKWDSWNKLKGT CCCCCHHCHHHCCCC | 31.28 | 29779826 | |
61 | Acetylation | AKWDSWNKLKGTSKE CCHHCHHHCCCCCHH | 45.37 | 22902405 | |
63 | Acetylation | WDSWNKLKGTSKENA HHCHHHCCCCCHHHH | 62.85 | 26302492 | |
67 | Acetylation | NKLKGTSKENAMKTY HHCCCCCHHHHHHHH | 55.62 | 22902405 | |
72 | Acetylation | TSKENAMKTYVEKVE CCHHHHHHHHHHHHH | 34.00 | 22902405 | |
77 | Ubiquitination | AMKTYVEKVEELKKK HHHHHHHHHHHHHHH | 44.92 | - | |
77 | Succinylation | AMKTYVEKVEELKKK HHHHHHHHHHHHHHH | 44.92 | - | |
77 | Acetylation | AMKTYVEKVEELKKK HHHHHHHHHHHHHHH | 44.92 | 22902405 | |
77 | Succinylation | AMKTYVEKVEELKKK HHHHHHHHHHHHHHH | 44.92 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ACBP_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ACBP_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ACBP_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ACBP_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Acyl-CoA-binding protein in the rat. Purification, bindingcharacteristics, tissue concentrations and amino acid sequence."; Knudsen J., Hoejrup P., Hansen H.O., Hansen H.F., Roepstorff P.; Biochem. J. 262:513-519(1989). Cited for: PROTEIN SEQUENCE OF 2-87, AND ACETYLATION AT SER-2. |