UniProt ID | ABRAL_HUMAN | |
---|---|---|
UniProt AC | Q9P1F3 | |
Protein Name | Costars family protein ABRACL | |
Gene Name | ABRACL | |
Organism | Homo sapiens (Human). | |
Sequence Length | 81 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVTYPGELLLQGVHDDVDIILLQD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MNVDHEVN -------CCCHHHHH | 11.28 | 25944712 | |
20 | Acetylation | EIHRLGSKNADGKLS HHHHHCCCCCCCCEE | 55.12 | 23749302 | |
20 | Ubiquitination | EIHRLGSKNADGKLS HHHHHCCCCCCCCEE | 55.12 | 27667366 | |
25 | Ubiquitination | GSKNADGKLSVKFGV CCCCCCCCEEEEEEE | 37.83 | 29967540 | |
25 | Acetylation | GSKNADGKLSVKFGV CCCCCCCCEEEEEEE | 37.83 | 25953088 | |
38 | Ubiquitination | GVLFRDDKCANLFEA EEEECCHHHHHHHHH | 39.26 | 29967540 | |
39 | S-nitrosocysteine | VLFRDDKCANLFEAL EEECCHHHHHHHHHH | 3.79 | - | |
51 | Ubiquitination | EALVGTLKAAKRRKI HHHHHHHHHHHHCCE | 46.25 | - | |
51 | Acetylation | EALVGTLKAAKRRKI HHHHHHHHHHHHCCE | 46.25 | 25953088 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ABRAL_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ABRAL_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ABRAL_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ABRAL_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, AND MASS SPECTROMETRY. |