ABHD4_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ABHD4_HUMAN
• UniProt AC: Q8TB40
• Protein Name: Protein ABHD4 {ECO:0000305}
• Gene Name: ABHD4 {ECO:0000312|HGNC:HGNC:20154}
• Organism: Homo sapiens (Human).
• Sequence Length: 342
• Protein Description: Lysophospholipase selective for N-acyl phosphatidylethanolamine (NAPE). Contributes to the biosynthesis of N-acyl ethanolamines, including the endocannabinoid anandamide by hydrolyzing the sn-1 and sn-2 acyl chains from N-acyl phosphatidylethanolamine (NAPE) generating glycerophospho-N-acyl ethanolamine (GP-NAE), an intermediate for N-acyl ethanolamine biosynthesis. Hydrolyzes substrates bearing saturated, monounsaturated, polyunsaturated N-acyl chains. Shows no significant activity towards other lysophospholipids, including lysophosphatidylcholine, lysophosphatidylethanolamine and lysophosphatidylserine (By similarity)..
• Protein Sequence: MADDLEQQSQGWLSSWLPTWRPTSMSQLKNVEARILQCLQNKFLARYVSLPNQNKIWTVTVSPEQNDRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPAFPRDPEGAEDEFVTSIETWRETMGIPSMILLGHSLGGFLATSYSIKYPDRVKHLILVDPWGFPLRPTNPSEIRAPPAWVKAVASVLGRSNPLAVLRVAGPWGPGLVQRFRPDFKRKFADFFEDDTISEYIYHCNAQNPSGETAFKAMMESFGWARRPMLERIHLIRKDVPITMIYGSDTWIDTSTGKKVKMQRPDSYVRDMEIKGASHHVYADQPHIFNAVVEEICDSVD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
14	Phosphorylation	QQSQGWLSSWLPTWR HHHHHHHHHHCCCCC	16.98	30631047
24	Phosphorylation	LPTWRPTSMSQLKNV CCCCCCCCHHHHCCH	21.08	25332170
26	Phosphorylation	TWRPTSMSQLKNVEA CCCCCCHHHHCCHHH	31.93	25332170
42	Ubiquitination	ILQCLQNKFLARYVS HHHHHHHHHHHHHCC	28.88	-
49	Phosphorylation	KFLARYVSLPNQNKI HHHHHHCCCCCCCCE	29.22	25690035
146	Phosphorylation	SMILLGHSLGGFLAT HHHHHCCCHHHHHHC	27.23	46157069
154	Phosphorylation	LGGFLATSYSIKYPD HHHHHHCCCCCCCCC	15.98	26091039
156	Phosphorylation	GFLATSYSIKYPDRV HHHHCCCCCCCCCCC	16.63	24719451
168	Ubiquitination	DRVKHLILVDPWGFP CCCEEEEEECCCCCC	4.50	23000965
192	Ubiquitination	RAPPAWVKAVASVLG CCCCHHHHHHHHHHC	26.83	23000965
228	Ubiquitination	FRPDFKRKFADFFED HCCHHHHHHHHHCCC	45.56	29967540
284	Phosphorylation	IRKDVPITMIYGSDT HCCCCCEEEEECCCC	7.46	26074081
287	Phosphorylation	DVPITMIYGSDTWID CCCEEEEECCCCEEE	10.35	26074081
289	Phosphorylation	PITMIYGSDTWIDTS CEEEEECCCCEEECC	18.20	26074081
291	Phosphorylation	TMIYGSDTWIDTSTG EEEECCCCEEECCCC	26.47	26074081
295	Phosphorylation	GSDTWIDTSTGKKVK CCCCEEECCCCCEEE	21.03	26074081
296	Phosphorylation	SDTWIDTSTGKKVKM CCCEEECCCCCEEEE	31.26	26074081
297	Phosphorylation	DTWIDTSTGKKVKMQ CCEEECCCCCEEEEC	55.93	26074081
309	Phosphorylation	KMQRPDSYVRDMEIK EECCCCCCEEEEEEC	13.59	7457049

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ABHD4_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ABHD4_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ABHD4_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of ABHD4_HUMAN !!

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.