UniProt ID | AB17A_RAT | |
---|---|---|
UniProt AC | Q5XIJ5 | |
Protein Name | Alpha/beta hydrolase domain-containing protein 17A {ECO:0000305} | |
Gene Name | Abhd17a {ECO:0000312|RGD:1359682} | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 310 | |
Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . Recycling endosome membrane Lipid-anchor Cytoplasmic side . Cell projection, dendritic spine . Cell junction, synapse, postsynaptic cell membrane, postsynaptic density . |
|
Protein Description | Hydrolyzes fatty acids from S-acylated cysteine residues in proteins. [PubMed: 27307232 Has depalmitoylating activity towards NRAS (By similarity Has depalmitoylating activity towards DLG4/PSD95] | |
Protein Sequence | MNGLSVSELCCLFCCPPCPGRIAAKLAFLPPEPTYSLVPEPEPGPGGAGAAPSGPLRTSAATPGRWKIHLTERADFQYGQRELDTIEVFVTKSARANRIACMYVRCVPGARYTVLFSHGNAVDLGQMCSFYVGLGTRIGCNIFSYDYSGYGISSGRPSEKNLYADIDAAWQALRTRYGISPDSIILYGQSIGTVPTVDLASRYECAAVVLHSPLTSGMRVAFPDTKKTYCFDAFPNIEKVSKITSPVLIIHGTEDEVIDFSHGLALYERCPKAVEPLWVEGAGHNDIELYSQYLERLRRFISQELPSQRT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
62 | Phosphorylation | PLRTSAATPGRWKIH CCCCCCCCCCEEEEE | 25403869 | ||
92 | Ubiquitination | TIEVFVTKSARANRI EEEEEEECHHHHCCE | - | ||
226 | Ubiquitination | RVAFPDTKKTYCFDA EEECCCCCCEEEECC | - | ||
302 | Phosphorylation | ERLRRFISQELPSQR HHHHHHHHHHCCCCC | - | ||
307 | Phosphorylation | FISQELPSQRT---- HHHHHCCCCCC---- | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AB17A_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AB17A_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AB17A_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of AB17A_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...