AAT3_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: AAT3_ARATH
• UniProt AC: P46644
• Protein Name: Aspartate aminotransferase 3, chloroplastic
• Gene Name: ASP3
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 449
• Subcellular Localization: Plastid, chloroplast . accumulates in stromules, which are membrane-bound protrusions of the plastid envelope containing soluble stroma. Stromules are often found connecting plastids within a cell.
• Protein Description: Amino acid aminotransferase important for the metabolism of amino acids and Krebs-cycle related organic acids. No activity with D-Asp or D-Ala as amino donors. In plants, it is involved in nitrogen metabolism and in aspects of carbon and energy metabolism..
• Protein Sequence: MKTTHFSSSSSSDRRIGALLRHLNSGSDSDNLSSLYASPTSGGTGGSVFSHLVQAPEDPILGVTVAYNKDPSPVKLNLGVGAYRTEEGKPLVLNVVRKAEQQLINDRTRIKEYLPIVGLVEFNKLSAKLILGADSPAIRENRITTVECLSGTGSLRVGGEFLAKHYHQKTIYITQPTWGNHPKIFTLAGLTVKTYRYYDPATRGLNFQGLLEDLGAAAPGSIVLLHACAHNPTGVDPTIQQWEQIRKLMRSKGLMPFFDSAYQGFASGSLDTDAKPIRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKSADVAGRVESQLKLVIRPMYSSPPIHGASIVAVILRDKNLFNEWTLELKAMADRIISMRKQLFEALRTRGTPGDWSHIIKQIGMFTFTGLNPAQVSFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAIHAVVTKAV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
144	Phosphorylation	AIRENRITTVECLSG HHHHCCEEEEEECCC	22.88	24894044
145	Phosphorylation	IRENRITTVECLSGT HHHCCEEEEEECCCC	16.37	24894044
295	N6-(pyridoxal phosphate)lysine	LVAQSYAKNMGLYGE EEEEEHHHHCCCCCC	38.95	-
295	Other	LVAQSYAKNMGLYGE EEEEEHHHHCCCCCC	38.95	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of AAT3_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of AAT3_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of AAT3_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.