UniProt ID | AAT3_ARATH | |
---|---|---|
UniProt AC | P46644 | |
Protein Name | Aspartate aminotransferase 3, chloroplastic | |
Gene Name | ASP3 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 449 | |
Subcellular Localization | Plastid, chloroplast . accumulates in stromules, which are membrane-bound protrusions of the plastid envelope containing soluble stroma. Stromules are often found connecting plastids within a cell. | |
Protein Description | Amino acid aminotransferase important for the metabolism of amino acids and Krebs-cycle related organic acids. No activity with D-Asp or D-Ala as amino donors. In plants, it is involved in nitrogen metabolism and in aspects of carbon and energy metabolism.. | |
Protein Sequence | MKTTHFSSSSSSDRRIGALLRHLNSGSDSDNLSSLYASPTSGGTGGSVFSHLVQAPEDPILGVTVAYNKDPSPVKLNLGVGAYRTEEGKPLVLNVVRKAEQQLINDRTRIKEYLPIVGLVEFNKLSAKLILGADSPAIRENRITTVECLSGTGSLRVGGEFLAKHYHQKTIYITQPTWGNHPKIFTLAGLTVKTYRYYDPATRGLNFQGLLEDLGAAAPGSIVLLHACAHNPTGVDPTIQQWEQIRKLMRSKGLMPFFDSAYQGFASGSLDTDAKPIRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKSADVAGRVESQLKLVIRPMYSSPPIHGASIVAVILRDKNLFNEWTLELKAMADRIISMRKQLFEALRTRGTPGDWSHIIKQIGMFTFTGLNPAQVSFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAIHAVVTKAV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
144 | Phosphorylation | AIRENRITTVECLSG HHHHCCEEEEEECCC | 22.88 | 24894044 | |
145 | Phosphorylation | IRENRITTVECLSGT HHHCCEEEEEECCCC | 16.37 | 24894044 | |
295 | N6-(pyridoxal phosphate)lysine | LVAQSYAKNMGLYGE EEEEEHHHHCCCCCC | 38.95 | - | |
295 | Other | LVAQSYAKNMGLYGE EEEEEHHHHCCCCCC | 38.95 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AAT3_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AAT3_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AAT3_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...