AAT2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: AAT2_ARATH
• UniProt AC: P46645
• Protein Name: Aspartate aminotransferase, cytoplasmic isozyme 1
• Gene Name: ASP2
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 405
• Subcellular Localization: Cytoplasm .
• Protein Description: Important for the metabolism of amino acids and Krebs-cycle related organic acids. Involved in plant nitrogen metabolism of Asp and Asp-derived amino acids and in the synthesis of Asp/Asn for seed storage. [PubMed: 12068109 May be involved in the assessment of the pyridoxal phosphate levels in the cell]
• Protein Sequence: MDSVFSNVARAPEDPILGVTVAYNNDPSPVKINLGVGAYRTEEGKPLVLDVVRKAEQQLVNDPSRVKEYIPIVGISDFNKLSAKLILGADSPAITESRVTTVQCLSGTGSLRVGAEFLKTHYHQSVIYIPKPTWGNHPKVFNLAGLSVEYFRYYDPATRGLDFKGLLEDLGAAPSGAIVLLHACAHNPTGVDPTSEQWEQIRQLMRSKSLLPFFDSAYQGFASGSLDTDAQSVRTFVADGGECLIAQSYAKNMGLYGERVGALSIVCKSADVASKVESQVKLVVRPMYSSPPIHGASIVATILKSSDMYNNWTIELKEMADRIKSMRQQLFEAIQARGTPGDWSHIIKQIGMFTFTGLNKEQVEFMTKEFHIYMTSDGRISMAGLSSKTVPHLADAMHAAVTRLG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MDSVFSNV -------CCCHHHHC	8.60	22223895
3	Phosphorylation	-----MDSVFSNVAR -----CCCHHHHCCC	24.62	19880383
6	Phosphorylation	--MDSVFSNVARAPE --CCCHHHHCCCCCC	28.39	23820729
28	Phosphorylation	VAYNNDPSPVKINLG EEECCCCCCEEEEEE	45.23	19880383
251	N6-(pyridoxal phosphate)lysine	LIAQSYAKNMGLYGE EEEEEHHHHCCCCCC	38.95	-
251	Other	LIAQSYAKNMGLYGE EEEEEHHHHCCCCCC	38.95	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of AAT2_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of AAT2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of AAT2_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of AAT2_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.