dbPTM

AAGAB_RAT - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	AAGAB_RAT
UniProt AC	Q9R0Z7
Protein Name	Alpha- and gamma-adaptin-binding protein p34
Gene Name	Aagab
Organism	Rattus norvegicus (Rat).
Sequence Length	315
Subcellular Localization	Cytoplasm, cytosol.
Protein Description	May be involved in endocytic recycling of growth factor receptors such as EGFR..
Protein Sequence	MAAGVPCALVTSCSATFTGDRLVQHILGTEDAVVEATSSDAVRFYPWTIDNKYYSAEVNLCVVPSKCRVTAEIAEAVQAFVVYFDSTQKSGLDSVSSWLPLAETWLPEVMILVCDRVCEDGINRQQAQEWCIKHGFELVELCPEELPEEDDDFPESTGVKRIVQALNANVWSNVVMKNDRSQGFSLLNSLAGASRSVGSAESCQCEQEPSPTAERTESLPGHRSGACGPAGAQVDSIVDPMLDLDIQELASLTTGGGDLENFERLFSKLKEMKDKAATLPHEQRKLHAEKVAKAFWMAIGGDRDEIEGLSSDDEH

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
196	Phosphorylation	SLAGASRSVGSAESC HHHCCCCCCCCHHHC	28.47	28551015
199	Phosphorylation	GASRSVGSAESCQCE CCCCCCCCHHHCCCC	27.06	28551015
202	Phosphorylation	RSVGSAESCQCEQEP CCCCCHHHCCCCCCC	14.81	28551015
210	Phosphorylation	CQCEQEPSPTAERTE CCCCCCCCCCCCCCC	33.84	27097102
212	Phosphorylation	CEQEPSPTAERTESL CCCCCCCCCCCCCCC	45.55	23984901
216	Phosphorylation	PSPTAERTESLPGHR CCCCCCCCCCCCCCC	22.79	23984901
218	Phosphorylation	PTAERTESLPGHRSG CCCCCCCCCCCCCCC	38.97	23984901
310	Phosphorylation	RDEIEGLSSDDEH-- HHHHCCCCCCCCC--	42.45	27097102
311	Phosphorylation	DEIEGLSSDDEH--- HHHCCCCCCCCC---	54.87	27097102

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of AAGAB_RAT !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of AAGAB_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of AAGAB_RAT !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of AAGAB_RAT !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of AAGAB_RAT

Related Literatures of Post-Translational Modification