dbPTM

AAGAB_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	AAGAB_MOUSE
UniProt AC	Q8R2R3
Protein Name	Alpha- and gamma-adaptin-binding protein p34
Gene Name	Aagab
Organism	Mus musculus (Mouse).
Sequence Length	316
Subcellular Localization	Cytoplasm, cytosol.
Protein Description	May be involved in endocytic recycling of growth factor receptors such as EGFR..
Protein Sequence	MAAGVPCALVTSCSATFTGDRLVQHILGTEDAVVEATSSDAVRFYPWTIDNKYYSAEINLCVVPSKFLVTAEIAESVQAFVVYFDSTQKSGLDSVSSWLPLAEAWLAEVMILVCDRVCDDGINRQQAQEWCIKHGFELVELNPEELPEEDDDFPESTGVKRIVQALNANVWSNVVMKSDRSQGFSLLNSLAGANRRVASAESCHSEQQEPSPTAERTESLPGHHSGACGSAGAQVDSIVDPMLDLDIQELASLTTGGGDLENFERLFSKLKEMKDKAATLPHEQRKLHAEKVAKAFWMAIGGDRDEIEGLSSDDEH

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
172	Phosphorylation	ALNANVWSNVVMKSD HHCCCCCCCEEECCC	18.57	18330071
178	Phosphorylation	WSNVVMKSDRSQGFS CCCEEECCCHHHCHH	21.84	51457077
199	Phosphorylation	GANRRVASAESCHSE HHCHHHHCHHHHCCC	29.70	25619855
202	Phosphorylation	RRVASAESCHSEQQE HHHHCHHHHCCCCCC	19.49	25619855
205	Phosphorylation	ASAESCHSEQQEPSP HCHHHHCCCCCCCCC	41.23	25619855
211	Phosphorylation	HSEQQEPSPTAERTE CCCCCCCCCCCCHHC	33.84	26824392
213	Phosphorylation	EQQEPSPTAERTESL CCCCCCCCCCHHCCC	45.55	25619855
279	Phosphorylation	EMKDKAATLPHEQRK HHHHHHHCCCHHHHH	45.76	22817900
311	Phosphorylation	RDEIEGLSSDDEH-- HHHHCCCCCCCCC--	42.45	25521595
312	Phosphorylation	DEIEGLSSDDEH--- HHHCCCCCCCCC---	54.87	25521595

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of AAGAB_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of AAGAB_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of AAGAB_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of AAGAB_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of AAGAB_MOUSE

Related Literatures of Post-Translational Modification