| UniProt ID | AA2BR_HUMAN | |
|---|---|---|
| UniProt AC | P29275 | |
| Protein Name | Adenosine receptor A2b | |
| Gene Name | ADORA2B | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 332 | |
| Subcellular Localization |
Cell membrane Multi-pass membrane protein. |
|
| Protein Description | Receptor for adenosine. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.. | |
| Protein Sequence | MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFAIPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGTRARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMSYMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIVGIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYTFHKIISRYLLCQADVKSGNGQAGVQPALGVGL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 153 | N-linked_Glycosylation | SKDSATNNCTEPWDG CCCCCCCCCCCCCCC | 29.72 | UniProtKB CARBOHYD | |
| 163 | N-linked_Glycosylation | EPWDGTTNESCCLVK CCCCCCCCHHHHHHH | 38.74 | UniProtKB CARBOHYD | |
| 204 | Ubiquitination | IMLVIYIKIFLVACR HHHHHHHHHHHHHHH | 15.50 | - | |
| 299 | Phosphorylation | YRNRDFRYTFHKIIS HCCCCHHHHHHHHHH | 17.47 | 29759185 | |
| 300 | Phosphorylation | RNRDFRYTFHKIISR CCCCHHHHHHHHHHH | 18.27 | 29759185 | |
| 311 | S-palmitoylation | IISRYLLCQADVKSG HHHHHHHHHCCCCCC | 2.64 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AA2BR_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AA2BR_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AA2BR_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TPD54_HUMAN | TPD52L2 | physical | 21988832 | |
| ZN267_HUMAN | ZNF267 | physical | 21988832 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...