UniProt ID | AA1R_HUMAN | |
---|---|---|
UniProt AC | P30542 | |
Protein Name | Adenosine receptor A1 | |
Gene Name | ADORA1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 326 | |
Subcellular Localization |
Cell membrane Multi-pass membrane protein. |
|
Protein Description | Receptor for adenosine. The activity of this receptor is mediated by G proteins which inhibit adenylyl cyclase.. | |
Protein Sequence | MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGALVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVTPRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRCQPAPPIDEDLPEERPDD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
159 | N-linked_Glycosylation | VERAWAANGSMGEPV HHHHHHHCCCCCCCE | 35.01 | UniProtKB CARBOHYD | |
214 | "N6,N6-dimethyllysine" | IRKQLNKKVSASSGD HHHHHCCCCCCCCCC | 40.11 | - | |
214 | Methylation | IRKQLNKKVSASSGD HHHHHCCCCCCCCCC | 40.11 | - | |
224 | "N6,N6-dimethyllysine" | ASSGDPQKYYGKELK CCCCCHHHHHHHHHH | 45.91 | - | |
224 | Methylation | ASSGDPQKYYGKELK CCCCCHHHHHHHHHH | 45.91 | - | |
309 | S-palmitoylation | IWNDHFRCQPAPPID HHCCCCCCCCCCCCC | 5.78 | 10455026 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AA1R_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AA1R_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AA1R_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DRD1_HUMAN | DRD1 | physical | 10890919 | |
GNAI2_HUMAN | GNAI2 | physical | 11369591 | |
SNF8_HUMAN | SNF8 | physical | 21988832 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
D00045 | Adenosine (JAN/USP); Adenocard (TN); Adenoscan (TN) | |||||
D00227 | Aminophylline (USP/INN); Somophyllin (TN); Theophylline ethylenediamine (TN) | |||||
D00371 | Theophylline (JP16); Elixophyllin (TN); Quibron-t (TN); Theo-24 (TN); Theodur G (TN); Theolair (TN); | |||||
D00528 | Anhydrous caffeine (JP16); Caffeine (USP); Anhydrous caffeine (TN) | |||||
D01453 | Caffeine hydrate (JP16); Caffeine monohydrate; Caffeine (TN) | |||||
D01712 | Theophylline sodium acetate (JAN) | |||||
D01771 | Proxyphylline (JAN/INN); Monophyllin (TN) | |||||
D02017 | Choline theophylline (JAN); Oxtriphylline (USP); Choline theophyllinate (INN); Theophyline - choline | |||||
D02964 | Apaxifylline (USAN/INN) | |||||
D03051 | Bamifylline hydrochloride (USAN) | |||||
D03898 | Doxofylline (USAN/INN); Maxivent (TN) | |||||
D04006 | Enprofylline (USAN/INN) | |||||
D05429 | Aminophylline hydrate (JP16) | |||||
D05818 | Selodenoson (USAN/INN) | |||||
D06019 | Tecadenoson (USAN/INN) | |||||
D06103 | Theophylline (USP); Theophylline monohydrate; Accurbron (TN) | |||||
D06104 | Theophylline sodium glycinate (USP); Asbron (TN) | |||||
D07491 | Bamifylline (INN) | |||||
D07603 | Caffeine citrate (USP); Cafcit (TN) | |||||
D08989 | Rolofylline (USAN) | |||||
D09684 | Tonapofylline (USAN/INN) | |||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...