UniProt ID | A6_DROME | |
---|---|---|
UniProt AC | O46341 | |
Protein Name | Protein a6 | |
Gene Name | a6 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 409 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MNQKHSEPFYISPRLFDNRRLKRRRCRWMERLLEHQRICMARMRDQVALASKTDRQLSHLQRRHVASTLQPDVTIDLLSDDDETPSAGQPAAAGHNRLLIPAPGHRAHRTGRRQAPRRAATHSYPVTDSILITSDDEHNEQEPSSTARVRSQLSMRSPPPLAPLTQSETIEEVTVSLVPRTSTTANCLTRVSGHPKPCRASTAASNGFATAEGGEGGNETGCFLEVDVGGGITATLPDETTVHTVIANRIYELSLSKLREGLAFSGVPEYTNDLMPEQLQKLSPALRAKVAPLVAPSPPTPISLKLSSDLSISLISDEDDCESTGPHVNGGVGTEPVHPVVVAAAEAHAAAKLLKQQQPQLSVVQHLQYVGGGLAAPVALALPVMAANPTSSASVVALPLQLPRRRKLG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
79 | Phosphorylation | DVTIDLLSDDDETPS CCEEEECCCCCCCCC | 46.41 | 22817900 | |
86 | Phosphorylation | SDDDETPSAGQPAAA CCCCCCCCCCCCCCC | 53.07 | 18327897 | |
133 | Phosphorylation | VTDSILITSDDEHNE CCCEEEEECCCCCCC | 23.74 | 22817900 | |
134 | Phosphorylation | TDSILITSDDEHNEQ CCEEEEECCCCCCCC | 35.75 | 22817900 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of A6_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of A6_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of A6_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
WWOX_DROME | Wwox | physical | 14605208 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-86; THR-133 AND SER-134,AND MASS SPECTROMETRY. |