| UniProt ID | A6_DROME | |
|---|---|---|
| UniProt AC | O46341 | |
| Protein Name | Protein a6 | |
| Gene Name | a6 | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 409 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MNQKHSEPFYISPRLFDNRRLKRRRCRWMERLLEHQRICMARMRDQVALASKTDRQLSHLQRRHVASTLQPDVTIDLLSDDDETPSAGQPAAAGHNRLLIPAPGHRAHRTGRRQAPRRAATHSYPVTDSILITSDDEHNEQEPSSTARVRSQLSMRSPPPLAPLTQSETIEEVTVSLVPRTSTTANCLTRVSGHPKPCRASTAASNGFATAEGGEGGNETGCFLEVDVGGGITATLPDETTVHTVIANRIYELSLSKLREGLAFSGVPEYTNDLMPEQLQKLSPALRAKVAPLVAPSPPTPISLKLSSDLSISLISDEDDCESTGPHVNGGVGTEPVHPVVVAAAEAHAAAKLLKQQQPQLSVVQHLQYVGGGLAAPVALALPVMAANPTSSASVVALPLQLPRRRKLG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 79 | Phosphorylation | DVTIDLLSDDDETPS CCEEEECCCCCCCCC | 46.41 | 22817900 | |
| 86 | Phosphorylation | SDDDETPSAGQPAAA CCCCCCCCCCCCCCC | 53.07 | 18327897 | |
| 133 | Phosphorylation | VTDSILITSDDEHNE CCCEEEEECCCCCCC | 23.74 | 22817900 | |
| 134 | Phosphorylation | TDSILITSDDEHNEQ CCEEEEECCCCCCCC | 35.75 | 22817900 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of A6_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of A6_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of A6_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| WWOX_DROME | Wwox | physical | 14605208 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-86; THR-133 AND SER-134,AND MASS SPECTROMETRY. | |