dbPTM

A6_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	A6_DROME
UniProt AC	O46341
Protein Name	Protein a6
Gene Name	a6
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	409
Subcellular Localization
Protein Description
Protein Sequence	MNQKHSEPFYISPRLFDNRRLKRRRCRWMERLLEHQRICMARMRDQVALASKTDRQLSHLQRRHVASTLQPDVTIDLLSDDDETPSAGQPAAAGHNRLLIPAPGHRAHRTGRRQAPRRAATHSYPVTDSILITSDDEHNEQEPSSTARVRSQLSMRSPPPLAPLTQSETIEEVTVSLVPRTSTTANCLTRVSGHPKPCRASTAASNGFATAEGGEGGNETGCFLEVDVGGGITATLPDETTVHTVIANRIYELSLSKLREGLAFSGVPEYTNDLMPEQLQKLSPALRAKVAPLVAPSPPTPISLKLSSDLSISLISDEDDCESTGPHVNGGVGTEPVHPVVVAAAEAHAAAKLLKQQQPQLSVVQHLQYVGGGLAAPVALALPVMAANPTSSASVVALPLQLPRRRKLG

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
79	Phosphorylation	DVTIDLLSDDDETPS CCEEEECCCCCCCCC	46.41	22817900
86	Phosphorylation	SDDDETPSAGQPAAA CCCCCCCCCCCCCCC	53.07	18327897
133	Phosphorylation	VTDSILITSDDEHNE CCCEEEEECCCCCCC	23.74	22817900
134	Phosphorylation	TDSILITSDDEHNEQ CCEEEEECCCCCCCC	35.75	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of A6_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of A6_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of A6_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
WWOX_DROME	Wwox	physical	14605208

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of A6_DROME

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-86; THR-133 AND SER-134,AND MASS SPECTROMETRY.	18327897 [Abstract]