dbPTM

7B2_RAT - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	7B2_RAT
UniProt AC	P27682
Protein Name	Neuroendocrine protein 7B2
Gene Name	Scg5
Organism	Rattus norvegicus (Rat).
Sequence Length	210
Subcellular Localization	Secreted. Neuroendocrine and endocrine secretory granules.
Protein Description	Acts as a molecular chaperone for PCSK2/PC2, preventing its premature activation in the regulated secretory pathway. Binds to inactive PCSK2 in the endoplasmic reticulum and facilitates its transport from there to later compartments of the secretory pathway where it is proteolytically matured and activated. Also required for cleavage of PCSK2 but does not appear to be involved in its folding. Plays a role in regulating pituitary hormone secretion. The C-terminal peptide inhibits PCSK2 in vitro..
Protein Sequence	MTSRMAILSGLLFWLLLEWNPAFAYSPRTPDRVSETDIQRLLHGVMEQLGIARPRVEYPAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPLGKTADDGCLENAPDTAEFSREFQLDQHLFDPEHDYPGLGKWNKKLLYEKMKGGQRRKRRSVNPYLQGKRLDNVVAKKSVPHFSEEEKEPE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
97	Phosphorylation	PNIVAELTGDNIPKD CHHHHHHHCCCCCCC	33.71	80823205
123	Phosphorylation	NPCPLGKTADDGCLE CCCCCCCCCCCCCHH	33.26	28432305
135	Phosphorylation	CLENAPDTAEFSREF CHHCCCCHHHHHHHH	27.33	28432305
139	Phosphorylation	APDTAEFSREFQLDQ CCCHHHHHHHHCCCH	23.54	23589303
203	Phosphorylation	KKSVPHFSEEEKEPE HCCCCCCCHHHCCCC	40.85	30411139

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
97	T	Phosphorylation	Kinase	FAM20C	Q8IXL6	PSP
135	T	Phosphorylation	Kinase	FAM20C	Q8IXL6	PSP

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of 7B2_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of 7B2_RAT !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of 7B2_RAT !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of 7B2_RAT

Related Literatures of Post-Translational Modification