4EBP3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: 4EBP3_HUMAN
• UniProt AC: O60516
• Protein Name: Eukaryotic translation initiation factor 4E-binding protein 3
• Gene Name: EIF4EBP3
• Organism: Homo sapiens (Human).
• Sequence Length: 100
• Protein Description: Repressor of translation initiation that regulates EIF4E activity by preventing its assembly into the eIF4F complex: hypophosphorylated form competes with EIF4G1/EIF4G3 and strongly binds to EIF4E, leading to repress translation. In contrast, hyperphosphorylated form dissociates from EIF4E, allowing interaction between EIF4G1/EIF4G3 and EIF4E, leading to initiation of translation..
• Protein Sequence: MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEMDI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSTSTSCPI ------CCCCCCCCC	30.94	29083192
3	Phosphorylation	-----MSTSTSCPIP -----CCCCCCCCCC	34.42	29083192
4	Phosphorylation	----MSTSTSCPIPG ----CCCCCCCCCCC	15.83	29083192
5	Phosphorylation	---MSTSTSCPIPGG ---CCCCCCCCCCCC	34.14	29083192
6	Phosphorylation	--MSTSTSCPIPGGR --CCCCCCCCCCCCC	20.05	29083192
20	Phosphorylation	RDQLPDCYSTTPGGT CCCCCCCEECCCCCE	19.21	28796482
21	Phosphorylation	DQLPDCYSTTPGGTL CCCCCCEECCCCCEE	31.94	30576142
22	Phosphorylation	QLPDCYSTTPGGTLY CCCCCEECCCCCEEE	15.55	30576142
23	Phosphorylation	LPDCYSTTPGGTLYA CCCCEECCCCCEEEE	17.62	22322096
27	Phosphorylation	YSTTPGGTLYATTPG EECCCCCEEEEECCC	23.63	22322096
29	Phosphorylation	TTPGGTLYATTPGGT CCCCCEEEEECCCCE	11.18	25262027
31	Phosphorylation	PGGTLYATTPGGTRI CCCEEEEECCCCEEE	21.70	22322096
32	Phosphorylation	GGTLYATTPGGTRII CCEEEEECCCCEEEE	16.27	22322096
36	Phosphorylation	YATTPGGTRIIYDRK EEECCCCEEEEECCC	25.30	28796482
40	Phosphorylation	PGGTRIIYDRKFLLE CCCEEEEECCCEEEE	13.81	26074081
51	Phosphorylation	FLLECKNSPIARTPP EEEECCCCCCCCCCC	11.81	28450419
56	Phosphorylation	KNSPIARTPPCCLPQ CCCCCCCCCCCCCCC	23.66	28450419
68	Phosphorylation	LPQIPGVTTPPTAPL CCCCCCCCCCCCCCH	39.23	26552605
69	Phosphorylation	PQIPGVTTPPTAPLS CCCCCCCCCCCCCHH	25.51	30576142
72	Phosphorylation	PGVTTPPTAPLSKLE CCCCCCCCCCHHHHH	41.95	26552605
76	Phosphorylation	TPPTAPLSKLEELKE CCCCCCHHHHHHHHH	33.85	26552605
77	Ubiquitination	PPTAPLSKLEELKEQ CCCCCHHHHHHHHHH	68.54	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of 4EBP3_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of 4EBP3_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of 4EBP3_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
IF4E2_HUMAN	EIF4E2	physical	16189514
IF4E_HUMAN	EIF4E	physical	12482586
IF4E_HUMAN	EIF4E	physical	9593750

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.