UniProt ID | 4EBP1_RAT | |
---|---|---|
UniProt AC | Q62622 | |
Protein Name | Eukaryotic translation initiation factor 4E-binding protein 1 | |
Gene Name | Eif4ebp1 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 117 | |
Subcellular Localization | ||
Protein Description | Repressor of translation initiation that regulates EIF4E activity by preventing its assembly into the eIF4F complex: hypophosphorylated form competes with EIF4G1/EIF4G3 and strongly binds to EIF4E, leading to repress translation. In contrast, hyperphosphorylated form dissociates from EIF4E, allowing interaction between EIF4G1/EIF4G3 and EIF4E, leading to initiation of translation (By similarity). Mediates the regulation of protein translation by hormones, growth factors and other stimuli that signal through the MAP kinase and mTORC1 pathways. [PubMed: 7939721] | |
Protein Sequence | MSAGSSCSQTPSRAIPTRRVALGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVAKTPPKDLPTIPGVTSPTSDEPPMQASQSHLHSSPEDKRAGGEESQFEMDI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSAGSSCSQ ------CCCCCCCCC | 41.14 | - | |
2 | Phosphorylation | ------MSAGSSCSQ ------CCCCCCCCC | 41.14 | 27097102 | |
5 | Phosphorylation | ---MSAGSSCSQTPS ---CCCCCCCCCCCC | 28.08 | 23984901 | |
10 | Phosphorylation | AGSSCSQTPSRAIPT CCCCCCCCCCCCCCC | 13.62 | 23984901 | |
12 | Phosphorylation | SSCSQTPSRAIPTRR CCCCCCCCCCCCCCC | 37.42 | 23984901 | |
17 | Phosphorylation | TPSRAIPTRRVALGD CCCCCCCCCCEEECC | 25.62 | 23984901 | |
33 | Phosphorylation | VQLPPGDYSTTPGGT CCCCCCCCCCCCCCC | 17.52 | 27097102 | |
34 | Phosphorylation | QLPPGDYSTTPGGTL CCCCCCCCCCCCCCE | 30.46 | 27097102 | |
35 | Phosphorylation | LPPGDYSTTPGGTLF CCCCCCCCCCCCCEE | 30.68 | 27097102 | |
36 | Phosphorylation | PPGDYSTTPGGTLFS CCCCCCCCCCCCEEE | 17.62 | 12944322 | |
40 | Phosphorylation | YSTTPGGTLFSTTPG CCCCCCCCEEECCCC | 30.46 | 27097102 | |
43 | Phosphorylation | TPGGTLFSTTPGGTR CCCCCEEECCCCCEE | 34.19 | 27097102 | |
44 | Phosphorylation | PGGTLFSTTPGGTRI CCCCEEECCCCCEEE | 29.67 | 23298284 | |
45 | Phosphorylation | GGTLFSTTPGGTRII CCCEEECCCCCEEEE | 20.81 | 12944322 | |
49 | Phosphorylation | FSTTPGGTRIIYDRK EECCCCCEEEEEECH | 25.30 | 27097102 | |
53 | Phosphorylation | PGGTRIIYDRKFLME CCCEEEEEECHHHHH | 13.81 | 23984901 | |
64 | Phosphorylation | FLMECRNSPVAKTPP HHHHHCCCCCCCCCC | 11.03 | 7939721 | |
69 | Phosphorylation | RNSPVAKTPPKDLPT CCCCCCCCCCCCCCC | 34.78 | 12944322 | |
76 | Phosphorylation | TPPKDLPTIPGVTSP CCCCCCCCCCCCCCC | 47.29 | 27097102 | |
81 | Phosphorylation | LPTIPGVTSPTSDEP CCCCCCCCCCCCCCC | 34.60 | 27097102 | |
82 | Phosphorylation | PTIPGVTSPTSDEPP CCCCCCCCCCCCCCC | 24.63 | 27097102 | |
84 | Phosphorylation | IPGVTSPTSDEPPMQ CCCCCCCCCCCCCCC | 48.88 | 27097102 | |
85 | Phosphorylation | PGVTSPTSDEPPMQA CCCCCCCCCCCCCCH | 43.28 | 27097102 | |
93 | Phosphorylation | DEPPMQASQSHLHSS CCCCCCHHHHHHCCC | 18.48 | 27097102 | |
95 | Phosphorylation | PPMQASQSHLHSSPE CCCCHHHHHHCCCHH | 26.06 | 27097102 | |
99 | Phosphorylation | ASQSHLHSSPEDKRA HHHHHHCCCHHHHHC | 54.68 | 27097102 | |
100 | Phosphorylation | SQSHLHSSPEDKRAG HHHHHCCCHHHHHCC | 22.89 | 27097102 | |
111 | Phosphorylation | KRAGGEESQFEMDI- HHCCCCCCCCCCCC- | 35.55 | 11146653 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
36 | T | Phosphorylation | Kinase | MAPK-FAMILY | - | GPS |
36 | T | Phosphorylation | Kinase | MTOR | P42346 | PSP |
36 | T | Phosphorylation | Kinase | MAPK1 | P28482 | GPS |
45 | T | Phosphorylation | Kinase | MAPK-FAMILY | - | GPS |
45 | T | Phosphorylation | Kinase | MAPK1 | P28482 | GPS |
45 | T | Phosphorylation | Kinase | MTOR | P42346 | Uniprot |
64 | S | Phosphorylation | Kinase | CSNK2A1 | P68400 | GPS |
64 | S | Phosphorylation | Kinase | DYRK2 | - | Uniprot |
64 | S | Phosphorylation | Kinase | MAPK-FAMILY | - | GPS |
64 | S | Phosphorylation | Kinase | MTOR | P42346 | Uniprot |
64 | S | Phosphorylation | Kinase | MAPK3 | P21708 | Uniprot |
64 | S | Phosphorylation | Kinase | MAPK1 | P63086 | Uniprot |
64 | S | Phosphorylation | Kinase | MAPK1 | P28482 | GPS |
64 | S | Phosphorylation | Kinase | PRKCA | P17252 | GPS |
69 | T | Phosphorylation | Kinase | MAPK1 | P28482 | GPS |
69 | T | Phosphorylation | Kinase | MTOR | P42346 | Uniprot |
69 | T | Phosphorylation | Kinase | MAPK-FAMILY | - | GPS |
82 | S | Phosphorylation | Kinase | MAPK1 | P28482 | GPS |
82 | S | Phosphorylation | Kinase | MTOR | P42346 | PSP |
82 | S | Phosphorylation | Kinase | MAPK-FAMILY | - | GPS |
99 | S | Phosphorylation | Kinase | CK2-FAMILY | - | GPS |
99 | S | Phosphorylation | Kinase | CSNK2A1 | P33674 | GPS |
100 | S | Phosphorylation | Kinase | DYRK2 | - | Uniprot |
111 | S | Phosphorylation | Kinase | CK2-FAMILY | - | GPS |
111 | S | Phosphorylation | Kinase | CSNK2A1 | P33674 | GPS |
111 | S | Phosphorylation | Kinase | ATM | Q13315 | PSP |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
36 | T | Phosphorylation |
| 22673903 |
36 | T | Phosphorylation |
| 22673903 |
36 | T | ubiquitylation |
| 22673903 |
45 | T | Phosphorylation |
| - |
45 | T | Phosphorylation |
| 8170978 |
45 | T | ubiquitylation |
| - |
64 | S | Phosphorylation |
| 7939721 |
64 | S | Phosphorylation |
| 7939721 |
64 | S | ubiquitylation |
| 7939721 |
69 | T | Phosphorylation |
| - |
69 | T | Phosphorylation |
| 8170978 |
69 | T | ubiquitylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of 4EBP1_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of 4EBP1_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Molecular cloning and tissue distribution of PHAS-I, an intracellulartarget for insulin and growth factors."; Hu C., Pang S., Kong X., Velleca M., Lawrence J.C. Jr.; Proc. Natl. Acad. Sci. U.S.A. 91:3730-3734(1994). Cited for: NUCLEOTIDE SEQUENCE [MRNA], PROTEIN SEQUENCE OF 18-33; 43-53; 62-80AND 98-117, PHOSPHORYLATION, AND TISSUE SPECIFICITY. | |
Phosphorylation | |
Reference | PubMed |
"PHAS-I as a link between mitogen-activated protein kinase andtranslation initiation."; Lin T.-A., Kong X., Haystead T.A.J., Pause A., Belsham G.J.,Sonenberg N., Lawrence J.C. Jr.; Science 266:653-656(1994). Cited for: FUNCTION, INTERACTION WITH EIF4E, PHOSPHORYLATION AT SER-64 BY MAPK1AND MAPK3, AND MUTAGENESIS OF SER-64. |