| UniProt ID | 3BHS1_HUMAN | |
|---|---|---|
| UniProt AC | P14060 | |
| Protein Name | 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 | |
| Gene Name | HSD3B1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 373 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Single-pass membrane protein. Mitochondrion membrane Single-pass membrane protein. |
|
| Protein Description | 3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids. Efficiently catalyzes the transformation of pregnenolone to progesterone, 17-alpha-hydroxypregnenolone to 17-alpha-hydroxyprogesterone, DHEA to 4-androstenedione, dihydrotestosterone to 5-alpha-androstane-3 beta,17 beta-diol, dehydroepiandrosterone to androstenedione and 5-alpha-androstan-3 beta,17 beta-diol to 5-alpha-dihydrotestosterone.. | |
| Protein Sequence | MTGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQNKTKLTVLEGDILDEPFLKRACQDVSVIIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPAPYPHSKKLAEKAVLAANGWNLKNGGTLYTCALRPMYIYGEGSRFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALQDPKKAPSIRGQFYYISDDTPHQSYDNLNYTLSKEFGLRLDSRWSFPLSLMYWIGFLLEIVSFLLRPIYTYRPPFNRHIVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKTVEWVGSLVDRHKETLKSKTQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 189 | Phosphorylation | TCALRPMYIYGEGSR EEEEECEEEECCCCC | 8.15 | 22210691 | |
| 191 | Phosphorylation | ALRPMYIYGEGSRFL EEECEEEECCCCCCE | 7.52 | 22210691 | |
| 195 | Phosphorylation | MYIYGEGSRFLSASI EEEECCCCCCEEHHH | 18.63 | 22210691 | |
| 254 | Phosphorylation | PSIRGQFYYISDDTP CCCCCEEEEECCCCC | 7.63 | - | |
| 260 | Phosphorylation | FYYISDDTPHQSYDN EEEECCCCCCCCCCC | 27.88 | - | |
| 265 | Phosphorylation | DDTPHQSYDNLNYTL CCCCCCCCCCCCEEE | 11.41 | - | |
| 302 | Phosphorylation | GFLLEIVSFLLRPIY HHHHHHHHHHHHHHH | 18.81 | 24719451 | |
| 330 | Phosphorylation | SNSVFTFSYKKAQRD ECCEEEEEHHHHHCH | 32.74 | 25262027 | |
| 331 | Phosphorylation | NSVFTFSYKKAQRDL CCEEEEEHHHHHCHH | 16.59 | 25262027 | |
| 340 | Phosphorylation | KAQRDLAYKPLYSWE HHHCHHCCCCCCCHH | 22.04 | 26657352 | |
| 345 | Phosphorylation | LAYKPLYSWEEAKQK HCCCCCCCHHHHHHH | 35.38 | 26657352 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of 3BHS1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of 3BHS1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of 3BHS1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of 3BHS1_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
