| UniProt ID | 2AB2A_ARATH | |
|---|---|---|
| UniProt AC | Q9XGR4 | |
| Protein Name | Serine/threonine protein phosphatase 2A regulatory subunit B''alpha | |
| Gene Name | B''ALPHA | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 538 | |
| Subcellular Localization | ||
| Protein Description | Regulatory subunit of type 2A protein phosphatase. Not involved in HMGR regulation in seedlings grown in standard medium, but negatively regulates root growth in response to salt.. | |
| Protein Sequence | MEIDGGNDVQILDPELLQLPGLSPVSLKENPHIAEELFSQWLSLPETGRLVKSLIDDTKSSTPVSVSKNCTSLNVACGSALPSVFLNSGTPPLSPRGSPGSPRFSRQKTSPSLQSPLKSVREPKRQLIPQFYFQHGRPPAKELREQCISMVDQFFSNYIDGLHMDEFKSITKEVCKLPSFLSSVLFRKIDTSGTGIVTRDAFIKYWVDGHMLAMDVASQIYNILRQPGCKYLRQADFKPVLDELLTTHPGLEFLRNTPEFQERYAETVIYRIFYYINRSGTGCITLRELKRGNLITAMQQVDEEDDINKVIRYFSYEHFYVIYCRFWELDGDHDFLIDKENLIKYGNHALTYRIVDRIFSQVPRKFTSKVEGKMSYEDFAYFILAEEDKSSEPSLEYWFKCIDLDGDGVITPNEMQFFYEEQLHRMECITQEPVLFEDILCQIFDMIKPEKENCITLQDLKASKLSGNIFNILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFAQREYVRLSMEEDVEEVSNGSADVWDEPLESPF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 61 | Phosphorylation | LIDDTKSSTPVSVSK HHHCCCCCCCEEECC | 25561503 | ||
| 62 | Phosphorylation | IDDTKSSTPVSVSKN HHCCCCCCCEEECCC | 25561503 | ||
| 65 | Phosphorylation | TKSSTPVSVSKNCTS CCCCCCEEECCCCCC | 22074104 | ||
| 67 | Phosphorylation | SSTPVSVSKNCTSLN CCCCEEECCCCCCCC | 22074104 | ||
| 109 | Phosphorylation | PRFSRQKTSPSLQSP CCCCCCCCCCCCCCC | 30291188 | ||
| 110 | Phosphorylation | RFSRQKTSPSLQSPL CCCCCCCCCCCCCCC | 19880383 | ||
| 112 | Phosphorylation | SRQKTSPSLQSPLKS CCCCCCCCCCCCCHH | 25561503 | ||
| 115 | Phosphorylation | KTSPSLQSPLKSVRE CCCCCCCCCCHHCCC | 25561503 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of 2AB2A_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of 2AB2A_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of 2AB2A_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of 2AB2A_ARATH !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
