dbPTM

1433S_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	1433S_MOUSE
UniProt AC	O70456
Protein Name	14-3-3 protein sigma
Gene Name	Sfn
Organism	Mus musculus (Mouse).
Sequence Length	248
Subcellular Localization	Cytoplasm . Nucleus . Secreted. May be secreted by a non-classical secretory pathway..
Protein Description	Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. When bound to KRT17, regulates protein synthesis and epithelial cell growth by stimulating Akt/mTOR pathway. May also regulate MDM2 autoubiquitination and degradation and thereby activate p53/TP53..
Protein Sequence	MERASLIQKAKLAEQAERYEDMAAFMKSAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVKEYREKVETELRGVCDTVLGLLDSHLIKGAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADSAGEEGGEAPEEPQS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	Phosphorylation	---MERASLIQKAKL ---CCHHHHHHHHHH	32.02	-
11	Malonylation	ASLIQKAKLAEQAER HHHHHHHHHHHHHHH	56.09	26320211
11	Ubiquitination	ASLIQKAKLAEQAER HHHHHHHHHHHHHHH	56.09	-
19	Phosphorylation	LAEQAERYEDMAAFM HHHHHHHHHHHHHHH	14.05	15286034
28	Phosphorylation	DMAAFMKSAVEKGEE HHHHHHHHHHHHCCC	26.26	40383
45	Phosphorylation	CEERNLLSVAYKNVV HHHHHHHHHHHHHHH	14.10	26824392
48	Phosphorylation	RNLLSVAYKNVVGGQ HHHHHHHHHHHHCHH	10.84	22817900
63	Phosphorylation	RAAWRVLSSIEQKSN HHHHHHHHHHHHHHC	26.81	15648052
64	Phosphorylation	AAWRVLSSIEQKSNE HHHHHHHHHHHHHCC	26.45	22324799
69	Phosphorylation	LSSIEQKSNEEGSEE HHHHHHHHCCCCCCC	49.52	40387
74	Phosphorylation	QKSNEEGSEEKGPEV HHHCCCCCCCCCHHH	45.95	15286034
90	Phosphorylation	EYREKVETELRGVCD HHHHHHHHHHHHHHH	43.22	24068923
98	Phosphorylation	ELRGVCDTVLGLLDS HHHHHHHHHHHHHHH	16.71	15286034
109	Ubiquitination	LLDSHLIKGAGDAES HHHHHHHCCCCCCHH	49.41	-
116	Phosphorylation	KGAGDAESRVFYLKM CCCCCCHHHEEEEEE	35.15	15286034
122	Ubiquitination	ESRVFYLKMKGDYYR HHHEEEEEECCCHHH	27.47	22790023
122	Acetylation	ESRVFYLKMKGDYYR HHHEEEEEECCCHHH	27.47	7298897
124	Ubiquitination	RVFYLKMKGDYYRYL HEEEEEECCCHHHHH	47.22	27667366
124	Acetylation	RVFYLKMKGDYYRYL HEEEEEECCCHHHHH	47.22	22826441
128	Phosphorylation	LKMKGDYYRYLAEVA EEECCCHHHHHHHHH	9.49	2021631
130	Phosphorylation	MKGDYYRYLAEVATG ECCCHHHHHHHHHCC	8.31	22817900
136	Phosphorylation	RYLAEVATGDDKKRI HHHHHHHCCCCHHHH	46.44	20139300
149	Phosphorylation	RIIDSARSAYQEAMD HHHHHHHHHHHHHHH	30.92	22871156
151	Phosphorylation	IDSARSAYQEAMDIS HHHHHHHHHHHHHCC	14.24	22871156
165	Phosphorylation	SKKEMPPTNPIRLGL CCCCCCCCCCCCHHH	47.99	22871156
186	Phosphorylation	FHYEIANSPEEAISL EEEEECCCHHHHHHH	25.35	45783
209	Phosphorylation	MADLHTLSEDSYKDS HHHHHHCCCCCCCCH	40.28	28507225
216	Phosphorylation	SEDSYKDSTLIMQLL CCCCCCCHHHHHHHH	22.44	23984901
217	Phosphorylation	EDSYKDSTLIMQLLR CCCCCCHHHHHHHHH	30.36	23984901
234	Phosphorylation	LTLWTADSAGEEGGE CEEEECCCCCCCCCC	35.39	25195567
248	Phosphorylation	EAPEEPQS------- CCCCCCCC-------	53.56	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of 1433S_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of 1433S_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of 1433S_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
TAU_MOUSE	Mapt	physical	19014373

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of 1433S_MOUSE

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Quantitative analysis of both protein expression and serine /threonine post-translational modifications through stable isotopelabeling with dithiothreitol."; Vosseller K., Hansen K.C., Chalkley R.J., Trinidad J.C., Wells L.,Hart G.W., Burlingame A.L.; Proteomics 5:388-398(2005). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-64 AND SER-216, AND MASSSPECTROMETRY.	15648052 [Abstract]