1433E_CHICK - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: 1433E_CHICK
• UniProt AC: Q5ZMT0
• Protein Name: 14-3-3 protein epsilon
• Gene Name: YWHAE {ECO:0000250|UniProtKB:P62262}
• Organism: Gallus gallus (Chicken).
• Sequence Length: 255
• Subcellular Localization: Nucleus . Cytoplasm .
• Protein Description: Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner..
• Protein Sequence: MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MDDREDLV -------CCHHHHHH	12.49	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of 1433E_CHICK !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of 1433E_CHICK !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of 1433E_CHICK !!

Protein-Protein Interaction

Oops, there are no PPI records of 1433E_CHICK !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.