dbPTM

14332_CAEEL - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	14332_CAEEL
UniProt AC	Q20655
Protein Name	14-3-3-like protein 2
Gene Name	ftt-2 {ECO:0000312\|WormBase:F52D10.3a}
Organism	Caenorhabditis elegans.
Sequence Length	248
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description	Required for extension of life-span by sir-2.1. [PubMed: 16777605 Promotes nuclear export of yap-1]
Protein Sequence	MSDGKEELVNRAKLAEQAERYDDMAASMKKVTELGAELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSEKKQQMAKEYREKVEKELRDICQDVLNLLDKFLIPKAGAAESKVFYLKMKGDYYRYLAEVASGDDRNSVVEKSQQSYQEAFDIAKDKMQPTHPIRLGLALNFSVFFYEILNAPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAATDDTDANETEGGN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSDGKEELV ------CCCCHHHHH	55.88	28854356
47	Phosphorylation	NEERNLLSVAYKNVV HHHHHHHHHHHHHHH	14.10	28854356
65	Phosphorylation	RSSWRVISSIEQKTE HHHHHHHHHHHHHCC	23.54	19530675
66	Phosphorylation	SSWRVISSIEQKTEG HHHHHHHHHHHHCCC	21.01	19530675
216	Phosphorylation	NEDSYKDSTLIMQLL CCCCCCCHHHHHHHH	22.44	30078680
217	Phosphorylation	EDSYKDSTLIMQLLR CCCCCCHHHHHHHHH	30.36	30078680
228	Phosphorylation	QLLRDNLTLWTSDAA HHHHHCCEEEECCCC	26.89	30078680
231	Phosphorylation	RDNLTLWTSDAATDD HHCCEEEECCCCCCC	21.60	30078680
232	Phosphorylation	DNLTLWTSDAATDDT HCCEEEECCCCCCCC	17.42	30078680
236	Phosphorylation	LWTSDAATDDTDANE EEECCCCCCCCCCCC	35.81	30078680
239	Phosphorylation	SDAATDDTDANETEG CCCCCCCCCCCCCCC	39.56	30078680
244	Phosphorylation	DDTDANETEGGN--- CCCCCCCCCCCC---	39.47	30078680

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of 14332_CAEEL !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of 14332_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of 14332_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of 14332_CAEEL !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of 14332_CAEEL

Related Literatures of Post-Translational Modification